KEGG   Pan paniscus (bonobo): 100979595
Entry
100979595         CDS       T02283                                 

Gene name
MCL1
Definition
(RefSeq) BCL2 family apoptosis regulator
  KO
K02539  myeloid leukemia cell differntiation protein MCL-1
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04151  PI3K-Akt signaling pathway
pps04210  Apoptosis
pps04630  JAK-STAT signaling pathway
pps05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100979595 (MCL1)
   04151 PI3K-Akt signaling pathway
    100979595 (MCL1)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100979595 (MCL1)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    100979595 (MCL1)
SSDB
Motif
Pfam: Bcl-2 Bcl-2_3
Other DBs
NCBI-GeneID: 100979595
NCBI-ProteinID: XP_003817356
UniProt: A0A2R9BYH6
Position
1
AA seq 350 aa
MFGLKRNAVIGLNLYCGGAGLGAGSGGATPPGGRLLATEKEASARREIGGGEAGAVIGGS
AGASPPSTLTPDSRRVARPPPIGAEVPDVTATPARLLFFAPTRRAAPLEEMEAPAADAIM
SPEEELDGYEPEPLGKRPAVLPLLELVGESGNNTSTDGSLPSTPPPAEEEEDELYRQSLE
IISRYLREQATGAKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNE
DDVKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLVR
TKRDWLVKQRGWDGFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
NT seq 1053 nt   +upstreamnt  +downstreamnt
atgtttggcctcaaaagaaacgcggtaatcggactcaacctctactgtgggggggccggc
ttgggggccggcagcggcggcgccacccctccgggagggcgacttttggctacggagaag
gaggcctcggcccggcgagagatagggggaggggaggccggcgcggtgattggcggaagc
gccggcgcaagccccccgtccaccctcacgccagactcccggagggtcgcgcggccgccg
cccattggcgccgaggtccccgacgtcaccgcgacccccgcgaggctgcttttcttcgcg
cccacccgccgcgcggcgccgcttgaggagatggaagccccggccgccgacgccatcatg
tcgcccgaagaggagctggacgggtacgagccggagcctctcgggaagcggccggctgtc
ctgcctctgctggagttggtcggggaatctggtaataacaccagtacggacgggtcacta
ccctcgacgccgccgccagcagaggaggaggaggacgagttgtaccggcagtcgctggag
attatctctcggtaccttcgggagcaggccaccggcgccaaggacacaaagccaatgggc
aggtctggggccaccagcaggaaggcgctggagaccttacgacgggttggggatggcgtg
cagcgcaaccatgagacggccttccaaggcatgcttcggaaactggacatcaaaaacgaa
gacgatgtgaaatcgttgtctcgagtgatgatccatgttttcagcgacggcgtaacaaac
tggggcaggattgtgactctcatttcttttggtgcctttgtggctaaacacttgaagacc
ataaaccaagaaagctgcatcgaaccattagcagaaagtatcacagacgttctcgtaagg
acaaaacgggactggctagttaaacaaagaggctgggatgggtttgtggagttcttccat
gtagaggacctagaaggtggcatcaggaatgtgctgctggcttttgcaggtgttgctgga
gtaggagctggtttggcatatctaataagatag

DBGET integrated database retrieval system