KEGG   Pan paniscus (bonobo): 100979670
Entry
100979670         CDS       T02283                                 

Gene name
LCK
Definition
(RefSeq) LCK proto-oncogene, Src family tyrosine kinase
  KO
K05856  lymphocyte cell-specific protein tyrosine kinase [EC:2.7.10.2]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04064  NF-kappa B signaling pathway
pps04380  Osteoclast differentiation
pps04650  Natural killer cell mediated cytotoxicity
pps04658  Th1 and Th2 cell differentiation
pps04659  Th17 cell differentiation
pps04660  T cell receptor signaling pathway
pps05135  Yersinia infection
pps05166  Human T-cell leukemia virus 1 infection
pps05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
pps05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    100979670 (LCK)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100979670 (LCK)
   04660 T cell receptor signaling pathway
    100979670 (LCK)
   04658 Th1 and Th2 cell differentiation
    100979670 (LCK)
   04659 Th17 cell differentiation
    100979670 (LCK)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100979670 (LCK)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100979670 (LCK)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100979670 (LCK)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100979670 (LCK)
  09163 Immune disease
   05340 Primary immunodeficiency
    100979670 (LCK)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pps01001]
    100979670 (LCK)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pps03036]
    100979670 (LCK)
Enzymes [BR:pps01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     100979670 (LCK)
Protein kinases [BR:pps01001]
 Non-receptor tyrosine kinases
  SRC family
   100979670 (LCK)
Chromosome and associated proteins [BR:pps03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    100979670 (LCK)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase SH2 SH3_1 SH3_2 SH3_9 ABC1 Haspin_kinase Kdo SH3_16
Other DBs
NCBI-GeneID: 100979670
NCBI-ProteinID: XP_003828198
UniProt: A0A2R9AKH9
Position
1
AA seq 509 aa
MGCGCSSHPEDDWMENIDVCENCHYPIVPLDGKGTLLIRNGSEVRDPLVTYEGSNPPASP
LQDNLVIALHSYEPSHDGDLGFEKGEQLRILEQSGEWWKAQSLTTGQEGFIPFNFVAKAN
SLEPEPWFFKNLSRKDAERQLLAPGNTHGSFLIRESESTAGSFSLSVRDFDQNQGEVVKH
YKIRNLDNGGFYISPRITFPGLHELVRHYTNASDGLCTRLSRPCQTQKPQKPWWEDEWEV
PRETLKLVERLGAGQFGEVWMGYYNGHTKVAVKSLKQGSMSPDAFLAEANLMKQLQHQRL
VRLYAVVTQEPIYIITEYMENGSLVDFLKTPSGIKLTINKLLDMAAQIAEGMAFIEERNY
IHRDLRAANILVSDTLSCKIADFGLARLIEDNEYTAREGAKFPIKWTAPEAINYGTFTIK
SDVWSFGILLTEIVTHGRIPYPGMTNPEVIQNLERGYRMVRPDNCPEELYQLMRLCWKER
PEDRPTFDYLRSVLEDFFTATEGQYQPQP
NT seq 1530 nt   +upstreamnt  +downstreamnt
atgggctgtggctgcagctcacacccggaagatgactggatggaaaacatcgatgtgtgt
gagaactgccattatcccatagtcccactggatggcaagggcacgctgctcatccgaaat
ggctctgaagtgcgggacccactggttacctacgaaggctccaatccgccggcttcccca
ctgcaagacaacctggttatcgctctgcacagctatgagccctctcacgacggagatctg
ggctttgagaagggggaacagctccgcatcctggagcagagcggcgagtggtggaaggcg
cagtccctgaccacgggccaggaaggcttcatccccttcaattttgtggccaaagcgaac
agcctggagcccgaaccctggttcttcaagaacctgagccgcaaggacgcggagcggcag
ctcctggcgcccgggaacactcacggctccttcctcatccgggagagcgagagcaccgcg
ggatcgttttcactgtcggtccgggacttcgaccagaaccagggagaggtggtgaaacat
tacaagatccgtaatctggacaacggtggcttctacatctcccctcgaatcacttttccc
ggcctgcatgaactggtccgccattacaccaatgcttcagatgggctgtgcacacggttg
agccgcccctgccagacccagaagccccagaagccgtggtgggaggacgagtgggaggtt
cccagggagacgctgaagctggtggagcggctgggggctggacagttcggggaggtgtgg
atggggtactacaacgggcacacgaaggtggcggtgaagagcctgaagcagggcagcatg
tccccggacgccttcctggccgaggccaacctcatgaagcagctgcaacaccagcggctg
gttcggctctatgctgtggtcacccaggagcccatctacatcatcactgaatacatggag
aatgggagtctagtggattttctcaagaccccttcaggcatcaagttgaccatcaacaaa
ctcctggacatggcagcccaaattgcagaaggcatggcattcattgaagagcggaattat
attcatcgtgaccttcgggctgccaacattctggtgtctgacaccctgagctgcaagatt
gcagactttggcctagcacgcctcattgaggacaacgagtacacagccagggagggggcc
aagtttcccattaagtggacagcgccagaagccattaactacgggacattcaccatcaag
tcagatgtgtggtcttttgggatcctgctgacggaaattgtcacccacggccgcatccct
tacccagggatgaccaacccggaggtgattcagaacctggagcgaggctaccgcatggtg
cgccctgacaactgtccagaggagctgtaccaactcatgaggctgtgctggaaggagcgc
ccagaggaccggcccacctttgactacctgcgcagtgtgctggaggacttcttcacggcc
acagagggccagtaccagcctcagccttga

DBGET integrated database retrieval system