KEGG   Pan paniscus (bonobo): 100979698Help
Entry
100979698         CDS       T02283                                 

Gene name
PRF1
Definition
(RefSeq) perforin 1
  KO
K07818  perforin 1
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04210  Apoptosis
pps04650  Natural killer cell mediated cytotoxicity
pps04940  Type I diabetes mellitus
pps05320  Autoimmune thyroid disease
pps05330  Allograft rejection
pps05332  Graft-versus-host disease
pps05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:pps00001]
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    100979698 (PRF1)
 Organismal Systems
  Immune system
   04650 Natural killer cell mediated cytotoxicity
    100979698 (PRF1)
 Human Diseases
  Immune diseases
   05320 Autoimmune thyroid disease
    100979698 (PRF1)
   05330 Allograft rejection
    100979698 (PRF1)
   05332 Graft-versus-host disease
    100979698 (PRF1)
  Cardiovascular diseases
   05416 Viral myocarditis
    100979698 (PRF1)
  Endocrine and metabolic diseases
   04940 Type I diabetes mellitus
    100979698 (PRF1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MACPF C2
Motif
Other DBs
NCBI-GeneID: 100979698
NCBI-ProteinID: XP_003815996
Position
10
AA seq 555 aa AA seqDB search
MAALLLLLGILLLLLPLPVPAPCHTAARSECKRSHKFVPGAWLAGEGVDVTSLRRSGSFP
VDTQRFLRPDGTCTLCENALQEGTLQRLPLALTNWRAQGSGCQRHVTRAKVSSTEAVARD
AARSIRNDWKVGLDVTPKPTGNVHVSVAGSHSQAANFAAQKTHQDQYTFSTDTVECRFYS
FHVVHTPPLHPDFKRALGDLPHHFNASTQPAYLRLISNYGTHFIRAVELGGRISALTALR
TCELALEGLTDNEVEDCLTVEAQVNIGIHGSISAEAKACEEKKKKHKMTASFHQTYRERH
SEVVGGHHTSINDLLFGIQAGPEQYSAWVNSLPGSPGLVDYTLEPLHVLLDSQDPRREAL
RRALSQYLTDRARWRDCSRPCPPGRQKSPRDPCQCVCHGSAVTTQDCCPRQRGLAQLEVT
FIQAWGLWGDWFTATDAYVKLFFGGQELRTSTVWDNNNPVWSVRLDFGDVLLVTGGPLRL
QVWDQDSGGDDDLLGTCDQAPKSGSHEVRCNLNHGHLKFRYHARCLPHLGGGTCLDYVPQ
MLLGEPPGNRSGAVW
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
atggcggcccttctgctcctcctgggcatccttctcctgctgctgcccctgcccgtccct
gccccatgccacacagccgcacgctcagagtgcaagcgcagccacaagttcgtgcctggt
gcatggctggccggggagggtgtggacgtgaccagcctccgccgctcgggctccttccca
gtggacacacaaaggttcctgcggcccgacggcacctgcaccctctgtgaaaatgcccta
caggagggcaccctccagcgcctgcctctggcgctcaccaactggcgggcccagggctct
ggctgccagcgccatgtaaccagggccaaagtcagctccactgaagctgtggcccgggat
gcggctcgtagcatccgcaacgactggaaggtcgggctggatgtgactcctaagcccacc
ggcaatgtgcatgtgtccgtggccggctcacactcacaggcagccaactttgcagcccag
aagacccaccaggaccagtacaccttcagcactgacacagtggagtgccgcttctacagt
ttccatgtggtacacactcccccgctgcaccctgacttcaagagggccctcggggacctg
ccccaccacttcaacgcctccacccagcccgcctacctcaggcttatctccaactacggc
acccacttcatccgggctgtggagctgggtggccgcatatcggccctcactgccctgcgc
acctgcgagctggccctggaagggctcacggacaacgaggtggaggactgcctgactgtc
gaggcccaggtcaacataggcatccatggcagcatctctgccgaagccaaggcctgtgag
gagaagaagaagaagcacaagatgacggcctccttccaccaaacctaccgggagcgccat
tcggaagtggttggcggccatcacacctccattaacgacctgctgtttgggatccaggcc
gggcccgagcagtactcagcctgggtaaactcgctgcccggcagccctggcctggtggac
tacaccctggaacccctgcacgtgctgctggacagccaggacccgcggcgggaggcactg
aggagggccctgagtcagtacctgacagacagggctcgctggagggactgcagccggccg
tgcccaccagggcggcagaagagcccccgagacccatgccagtgtgtgtgccatggctca
gcggtcaccacccaggactgctgccctcggcagaggggcctggcccagctggaggtgacc
ttcatccaagcatggggcctgtggggggactggttcactgccacggatgcctatgtgaag
ctcttctttggtggccaggagctgaggacgagcaccgtgtgggacaataacaaccccgtc
tggtcagtgcggctggattttggggatgtgctcctggtcacaggggggcccctgaggttg
caggtctgggatcaggactctggcggggacgatgacctccttggcacctgtgatcaggct
cccaagtctggttcccatgaggtgagatgcaacctgaatcatggccacctaaaattccgc
tatcatgccaggtgcttgccccacctgggaggaggcacctgcctggactatgtcccccaa
atgcttctgggggagcctccaggaaaccggagtggggccgtgtggtga

DBGET integrated database retrieval system