KEGG   Pan paniscus (bonobo): 100979698
Entry
100979698         CDS       T02283                                 

Gene name
PRF1
Definition
(RefSeq) perforin 1
  KO
K07818  perforin 1
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04210  Apoptosis
pps04650  Natural killer cell mediated cytotoxicity
pps04940  Type I diabetes mellitus
pps05320  Autoimmune thyroid disease
pps05330  Allograft rejection
pps05332  Graft-versus-host disease
pps05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:pps00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100979698 (PRF1)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100979698 (PRF1)
 09160 Human Diseases
  09163 Immune disease
   05320 Autoimmune thyroid disease
    100979698 (PRF1)
   05330 Allograft rejection
    100979698 (PRF1)
   05332 Graft-versus-host disease
    100979698 (PRF1)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100979698 (PRF1)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100979698 (PRF1)
SSDB
Motif
Pfam: MACPF C2
Other DBs
NCBI-GeneID: 100979698
NCBI-ProteinID: XP_003815996
UniProt: A0A2R9C5V2
Position
10
AA seq 555 aa
MAALLLLLGILLLLLPLPVPAPCHTAARSECKRSHKFVPGAWLAGEGVDVTSLRRSGSFP
VDTQRFLRPDGTCTLCENALQEGTLQRLPLALTNWRAQGSGCQRHVTRAKVSSTEAVARD
AARSIRNDWKVGLDVTPKPTGNVHVSVAGSHSQAANFAAQKTHQDQYTFSTDTVECRFYS
FHVVHTPPLHPDFKRALGDLPHHFNASTQPAYLRLISNYGTHFIRAVELGGRISALTALR
TCELALEGLTDNEVEDCLTVEAQVNIGIHGSISAEAKACEEKKKKHKMTASFHQTYRERH
SEVVGGHHTSINDLLFGIQAGPEQYSAWVNSLPGSPGLVDYTLEPLHVLLDSQDPRREAL
RRALSQYLTDRARWRDCSRPCPPGRQKSPRDPCQCVCHGSAVTTQDCCPRQRGLAQLEVT
FIQAWGLWGDWFTATDAYVKLFFGGQELRTSTVWDNNNPVWSVRLDFGDVLLVTGGPLRL
QVWDQDSGGDDDLLGTCDQAPKSGSHEVRCNLNHGHLKFRYHARCLPHLGGGTCLDYVPQ
MLLGEPPGNRSGAVW
NT seq 1668 nt   +upstreamnt  +downstreamnt
atggcggcccttctgctcctcctgggcatccttctcctgctgctgcccctgcccgtccct
gccccatgccacacagccgcacgctcagagtgcaagcgcagccacaagttcgtgcctggt
gcatggctggccggggagggtgtggacgtgaccagcctccgccgctcgggctccttccca
gtggacacacaaaggttcctgcggcccgacggcacctgcaccctctgtgaaaatgcccta
caggagggcaccctccagcgcctgcctctggcgctcaccaactggcgggcccagggctct
ggctgccagcgccatgtaaccagggccaaagtcagctccactgaagctgtggcccgggat
gcggctcgtagcatccgcaacgactggaaggtcgggctggatgtgactcctaagcccacc
ggcaatgtgcatgtgtccgtggccggctcacactcacaggcagccaactttgcagcccag
aagacccaccaggaccagtacaccttcagcactgacacagtggagtgccgcttctacagt
ttccatgtggtacacactcccccgctgcaccctgacttcaagagggccctcggggacctg
ccccaccacttcaacgcctccacccagcccgcctacctcaggcttatctccaactacggc
acccacttcatccgggctgtggagctgggtggccgcatatcggccctcactgccctgcgc
acctgcgagctggccctggaagggctcacggacaacgaggtggaggactgcctgactgtc
gaggcccaggtcaacataggcatccatggcagcatctctgccgaagccaaggcctgtgag
gagaagaagaagaagcacaagatgacggcctccttccaccaaacctaccgggagcgccat
tcggaagtggttggcggccatcacacctccattaacgacctgctgtttgggatccaggcc
gggcccgagcagtactcagcctgggtaaactcgctgcccggcagccctggcctggtggac
tacaccctggaacccctgcacgtgctgctggacagccaggacccgcggcgggaggcactg
aggagggccctgagtcagtacctgacagacagggctcgctggagggactgcagccggccg
tgcccaccagggcggcagaagagcccccgagacccatgccagtgtgtgtgccatggctca
gcggtcaccacccaggactgctgccctcggcagaggggcctggcccagctggaggtgacc
ttcatccaagcatggggcctgtggggggactggttcactgccacggatgcctatgtgaag
ctcttctttggtggccaggagctgaggacgagcaccgtgtgggacaataacaaccccgtc
tggtcagtgcggctggattttggggatgtgctcctggtcacaggggggcccctgaggttg
caggtctgggatcaggactctggcggggacgatgacctccttggcacctgtgatcaggct
cccaagtctggttcccatgaggtgagatgcaacctgaatcatggccacctaaaattccgc
tatcatgccaggtgcttgccccacctgggaggaggcacctgcctggactatgtcccccaa
atgcttctgggggagcctccaggaaaccggagtggggccgtgtggtga

DBGET integrated database retrieval system