KEGG   Pan paniscus (bonobo): 100979746
Entry
100979746         CDS       T02283                                 

Gene name
CCL22
Definition
(RefSeq) C-C motif chemokine ligand 22
  KO
K21095  C-C motif chemokine 22
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04060  Cytokine-cytokine receptor interaction
pps04061  Viral protein interaction with cytokine and cytokine receptor
pps04062  Chemokine signaling pathway
pps04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100979746 (CCL22)
   04061 Viral protein interaction with cytokine and cytokine receptor
    100979746 (CCL22)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    100979746 (CCL22)
   04062 Chemokine signaling pathway
    100979746 (CCL22)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pps04052]
    100979746 (CCL22)
Cytokines and growth factors [BR:pps04052]
 Cytokines
  Chemokines
   100979746 (CCL22)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 100979746
NCBI-ProteinID: XP_003823794
UniProt: A0A2R9C4E3
Position
16
AA seq 93 aa
MARLQTTLLVVLVLLAVALQATEAGPYGANMEDSVCCRDYVRYRLPLRVVKHFYWTSDSC
PRPGVVLLTFRDKEICADPRVPWVKMILNKLSQ
NT seq 282 nt   +upstreamnt  +downstreamnt
atggctcgcctacagaccacactcctggttgtccttgtcctccttgctgtggcgcttcaa
gcaactgaggcaggcccctacggcgccaacatggaagacagcgtctgctgccgtgattac
gtccgttaccgtctgcccctgcgcgtggtgaaacacttctactggacctcagactcctgc
ccgagacctggcgtggtgttgctaaccttcagggataaggagatctgtgccgatcccaga
gtgccctgggtgaagatgattctcaataagctgagccaatga

DBGET integrated database retrieval system