KEGG   Pan paniscus (bonobo): 100979807Help
Entry
100979807         CDS       T02283                                 

Gene name
NIP7
Definition
(RefSeq) NIP7, nucleolar pre-rRNA processing protein
  KO
K07565  60S ribosome subunit biogenesis protein NIP7
Organism
pps  Pan paniscus (bonobo)
Brite
KEGG Orthology (KO) [BR:pps00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:pps03009]
    100979807 (NIP7)
Ribosome biogenesis [BR:pps03009]
 Eukaryotic type
  Pre-60S particles
   Other pre-60S particles
    100979807 (NIP7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UPF0113_N UPF0113 PUA PP1 PEPCK_GTP
Motif
Other DBs
NCBI-GeneID: 100979807
NCBI-ProteinID: XP_003814602
UniProt: A0A2R8ZC01
Position
16
AA seq 180 aa AA seqDB search
MRPLTEEETRVMFEKIAKYIGENLQLLVDRPDGTYCFRLHNDRVYYVSEKIMKLAANISG
DKLVSLGTCFGKFTKTHKFRLHVTALDYLAPYAKYKVWIKPGAEQSFLYGNHVLKSGLGR
ITENTSQYQGVVVYSMADIPLGFGVAAKSTQDCRKVDPMAIVVFHQADIGEYVRHEETLT
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atgcggcctttgactgaagaggagacccgtgtcatgtttgagaagatagcgaaatacatt
ggggagaatcttcaactgctggtggaccggcccgatggcacctactgtttccgtctgcac
aacgaccgggtgtactatgtgagtgagaagattatgaagctggccgccaatatttccggg
gacaagctggtgtcgctggggacctgctttggaaaattcactaaaacccacaagtttcgg
ttgcacgtcacagctctggattaccttgcaccttatgccaagtataaagtttggataaag
cctggtgcagagcagtccttcctgtatgggaaccatgtgttgaaatctggtctgggtcga
atcactgaaaatacttctcagtaccagggcgtggtggtgtactccatggcagacatccct
ttgggttttggggtggcagccaaatctacacaagactgcagaaaagtagaccccatggcg
attgtggtatttcatcaagcagacattggggaatatgtgcggcatgaagagacgttgact
taa

DBGET integrated database retrieval system