KEGG   Pan paniscus (bonobo): 100979809
Entry
100979809         CDS       T02283                                 

Gene name
BCL2L1
Definition
(RefSeq) BCL2 like 1
  KO
K04570  Bcl-2-like 1 (apoptosis regulator Bcl-X)
Organism
pps  Pan paniscus (bonobo)
Pathway
pps01521  EGFR tyrosine kinase inhibitor resistance
pps01524  Platinum drug resistance
pps04014  Ras signaling pathway
pps04064  NF-kappa B signaling pathway
pps04115  p53 signaling pathway
pps04137  Mitophagy - animal
pps04140  Autophagy - animal
pps04151  PI3K-Akt signaling pathway
pps04210  Apoptosis
pps04215  Apoptosis - multiple species
pps04621  NOD-like receptor signaling pathway
pps04630  JAK-STAT signaling pathway
pps05012  Parkinson disease
pps05014  Amyotrophic lateral sclerosis
pps05022  Pathways of neurodegeneration - multiple diseases
pps05145  Toxoplasmosis
pps05162  Measles
pps05166  Human T-cell leukemia virus 1 infection
pps05168  Herpes simplex virus 1 infection
pps05170  Human immunodeficiency virus 1 infection
pps05200  Pathways in cancer
pps05202  Transcriptional misregulation in cancer
pps05212  Pancreatic cancer
pps05220  Chronic myeloid leukemia
pps05222  Small cell lung cancer
pps05225  Hepatocellular carcinoma
pps05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100979809 (BCL2L1)
   04630 JAK-STAT signaling pathway
    100979809 (BCL2L1)
   04064 NF-kappa B signaling pathway
    100979809 (BCL2L1)
   04151 PI3K-Akt signaling pathway
    100979809 (BCL2L1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100979809 (BCL2L1)
   04137 Mitophagy - animal
    100979809 (BCL2L1)
  09143 Cell growth and death
   04210 Apoptosis
    100979809 (BCL2L1)
   04215 Apoptosis - multiple species
    100979809 (BCL2L1)
   04115 p53 signaling pathway
    100979809 (BCL2L1)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    100979809 (BCL2L1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100979809 (BCL2L1)
   05202 Transcriptional misregulation in cancer
    100979809 (BCL2L1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    100979809 (BCL2L1)
   05225 Hepatocellular carcinoma
    100979809 (BCL2L1)
   05220 Chronic myeloid leukemia
    100979809 (BCL2L1)
   05222 Small cell lung cancer
    100979809 (BCL2L1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100979809 (BCL2L1)
   05170 Human immunodeficiency virus 1 infection
    100979809 (BCL2L1)
   05162 Measles
    100979809 (BCL2L1)
   05168 Herpes simplex virus 1 infection
    100979809 (BCL2L1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100979809 (BCL2L1)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    100979809 (BCL2L1)
   05014 Amyotrophic lateral sclerosis
    100979809 (BCL2L1)
   05022 Pathways of neurodegeneration - multiple diseases
    100979809 (BCL2L1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100979809 (BCL2L1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100979809 (BCL2L1)
   01524 Platinum drug resistance
    100979809 (BCL2L1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pps01009]
    100979809 (BCL2L1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pps03036]
    100979809 (BCL2L1)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pps02000]
    100979809 (BCL2L1)
Protein phosphatases and associated proteins [BR:pps01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100979809 (BCL2L1)
Chromosome and associated proteins [BR:pps03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    100979809 (BCL2L1)
Transporters [BR:pps02000]
 Other transporters
  Pores ion channels [TC:1]
   100979809 (BCL2L1)
SSDB
Motif
Pfam: Bcl-2 BH4 Bcl-2_3
Other DBs
NCBI-GeneID: 100979809
NCBI-ProteinID: XP_003814810
UniProt: A0A2R8Z9D7
Position
20
AA seq 233 aa
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLA
DSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAY
QSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAAWMATYLNDHLEP
WIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
NT seq 702 nt   +upstreamnt  +downstreamnt
atgtctcagagcaaccgggagctggtggttgactttctctcctacaagctttcccagaaa
ggatacagctggagtcagtttagtgatgtggaagagaacaggactgaggccccagaaggg
actgaatcggagatggagacccccagtgccatcaatggcaacccatcctggcacctggcg
gacagccccgcggtgaatggagccactggccacagcagcagtttggatgcccgggaggtg
atccccatggcagcagtaaagcaagcgctgagggaggcaggcgacgagtttgaactgcgg
taccggcgggcattcagtgacctgacatcccagctccacatcaccccagggacagcatat
cagagctttgaacaggtagtgaatgaactcttccgggatggggtaaactggggtcgcatt
gtggcctttttctccttcggcggggcactgtgcgtggaaagcgtagacaaggagatgcag
gtattggtgagtcggatcgcagcttggatggccacttacctgaatgaccacctagagcct
tggatccaggagaacggcggctgggatacttttgtggaactctatgggaacaatgcagca
gccgagagccgaaagggccaggaacgcttcaaccgctggttcctgacgggcatgactgtg
gccggcgtggttctgctgggctcactcttcagtcggaaatga

DBGET integrated database retrieval system