KEGG   Pan paniscus (bonobo): 100979816
Entry
100979816         CDS       T02283                                 

Gene name
LTA
Definition
(RefSeq) lymphotoxin alpha
  KO
K05468  lymphotoxin alpha (TNF superfamily, member 1)
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04060  Cytokine-cytokine receptor interaction
pps04061  Viral protein interaction with cytokine and cytokine receptor
pps04064  NF-kappa B signaling pathway
pps04668  TNF signaling pathway
pps04940  Type I diabetes mellitus
pps05166  Human T-cell leukemia virus 1 infection
pps05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    100979816 (LTA)
   04668 TNF signaling pathway
    100979816 (LTA)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100979816 (LTA)
   04061 Viral protein interaction with cytokine and cytokine receptor
    100979816 (LTA)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100979816 (LTA)
   05168 Herpes simplex virus 1 infection
    100979816 (LTA)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100979816 (LTA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pps04052]
    100979816 (LTA)
Cytokines and growth factors [BR:pps04052]
 Cytokines
  Tumor necrosis fators
   100979816 (LTA)
SSDB
Motif
Pfam: TNF
Other DBs
NCBI-GeneID: 100979816
NCBI-ProteinID: XP_003831645
UniProt: A0A2R9BST5
Position
6
AA seq 205 aa
MTPPERLFLPRVRGTTLHLLLLGLLLVLLPGAQGLPGVGLTPSAAQTARQHPKMHLAHST
LKPAAHLIGDPSKQNSLLWRANTDRAFLQDGFSLSNNSLLVPTSGIYFVYSQVVFSGKAY
SPKATSSPLYLAHEVQLFSSQYPFHVPLLSSQKMVYPGLQEPWLHSMYHGAAFQLTQGDQ
LSTHTDGIPHLVLSPSTVFFGAFAL
NT seq 618 nt   +upstreamnt  +downstreamnt
atgacaccacctgaacgtctcttcctcccaagggtgcgtggcaccaccctacacctcctc
cttctggggctgctgctggttctgctgcctggggcccaggggctccctggtgttggcctc
acaccttcagctgcccagactgcccgtcagcaccccaagatgcatcttgcccacagcacc
ctcaaacctgctgctcacctcattggagaccccagcaagcagaactcactgctctggaga
gcaaacacggaccgtgccttcctccaggatggtttctccttgagcaacaattctctcctg
gtccccaccagtggcatctacttcgtctactcccaggtggtcttctctgggaaagcctac
tctcccaaggccacctcctccccactctacctggcccatgaggtccagctcttctcctcc
cagtaccccttccacgtgcctctcctcagctcccagaagatggtgtatccagggctgcag
gaaccctggctgcactcgatgtaccatggggctgcgttccagctcacccagggagaccag
ctatccacccacacagatggcatcccccacctagtcctcagccctagtactgtcttcttt
ggagccttcgctctgtag

DBGET integrated database retrieval system