KEGG   Pan paniscus (bonobo): 100979946
Entry
100979946         CDS       T02283                                 

Gene name
CD3D
Definition
(RefSeq) CD3d molecule
  KO
K06450  T-cell surface glycoprotein CD3 delta chain
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04640  Hematopoietic cell lineage
pps04658  Th1 and Th2 cell differentiation
pps04659  Th17 cell differentiation
pps04660  T cell receptor signaling pathway
pps05142  Chagas disease
pps05162  Measles
pps05166  Human T-cell leukemia virus 1 infection
pps05169  Epstein-Barr virus infection
pps05170  Human immunodeficiency virus 1 infection
pps05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
pps05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:pps00001]
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100979946 (CD3D)
   04660 T cell receptor signaling pathway
    100979946 (CD3D)
   04658 Th1 and Th2 cell differentiation
    100979946 (CD3D)
   04659 Th17 cell differentiation
    100979946 (CD3D)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100979946 (CD3D)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100979946 (CD3D)
   05170 Human immunodeficiency virus 1 infection
    100979946 (CD3D)
   05162 Measles
    100979946 (CD3D)
   05169 Epstein-Barr virus infection
    100979946 (CD3D)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    100979946 (CD3D)
  09163 Immune disease
   05340 Primary immunodeficiency
    100979946 (CD3D)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:pps04090]
    100979946 (CD3D)
CD molecules [BR:pps04090]
 Proteins
  100979946 (CD3D)
SSDB
Motif
Pfam: Ig_4 ITAM Ig_5 DAP10
Other DBs
NCBI-GeneID: 100979946
NCBI-ProteinID: XP_003820102
UniProt: A0A2R8ZGT9
Position
11
AA seq 171 aa
MEHSTFLSGLVLATLLSQVSPFKIPIEELEDRVFVNCNTSVTWVEGTVGTLLSDITRLDL
GKRILDPRGIYRCNGTDTYKDKESTVQVHYRMCQSCVELDPATVAGIIVTDVIATLLLAL
GVFCFAGHETGRLSGAADTQALLRNDQVYQPLRDRDDVQYSRLGGNWARNK
NT seq 516 nt   +upstreamnt  +downstreamnt
atggaacatagcacgtttctgtctggcctggtactggctacccttctctcgcaagtgagc
cccttcaagatacctatagaggaacttgaggacagagtgtttgtgaattgcaataccagc
gtcacatgggtagagggaacggtgggaacactgctctcagacattacaagactggacctg
ggaaaacgcatcctggacccacgaggaatatataggtgtaatgggacagatacatacaag
gacaaagaatctaccgtgcaagttcattatcgaatgtgccagagctgtgtggagctggat
ccagccaccgtggctggcatcattgtcactgatgtcattgccactctgctccttgctttg
ggagtcttctgctttgctggacatgagactggaaggctgtctggggctgccgacacacaa
gctctgttgaggaatgaccaggtctatcagcccctccgagatcgagatgatgttcagtac
agccgccttggaggaaactgggctcggaacaagtga

DBGET integrated database retrieval system