KEGG   Pan paniscus (bonobo): 100979991
Entry
100979991         CDS       T02283                                 

Gene name
ICA1
Definition
(RefSeq) islet cell autoantigen 1
  KO
K19863  islet cell auto antigen 1
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04940  Type I diabetes mellitus
Brite
KEGG Orthology (KO) [BR:pps00001]
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100979991 (ICA1)
SSDB
Motif
Pfam: Arfaptin ICA69
Other DBs
NCBI-GeneID: 100979991
NCBI-ProteinID: XP_008976932
Position
7
AA seq 483 aa
MSGHKCSYPWDLQDRYAQDKSVVNKMQQKYWETKQAFIKATGKKEDEHVVASDADLDAKL
ELFHSIQRTCLDLSKAIVLYQKRICFLSQEENELGKFLRSQGFQDKTRAGKMMQATGKAL
CFSSQQRLALRNPLCRFHQEVETFRHRAISDTWLTVNRMEQCRTEYRGALLWMKDVSQEL
DPDLYKQMEKFRKVQTQVRLXKKNFDKLKMDVCQKVDLLGASRCNLLSHMLATYQTTLLH
FWEKTSHTMAAIHESFKGYQPYEFTTLKSLQDPMKKLVEKEEKKKITQQESTDAAVQEPS
QLISLEEENQRKESSSFKTEDGKSILSALDKSSTHTACSGPIDELLDMKSEEGACLGPVA
GTPEPEGADKDDLLLLNEIFNASSLEEGEFSKEWAAVFGDGQVKEPVPTMALGEPDPKAQ
TGSGFLPSQLLDQNMKDLQASLQEPAKAASDLTAWFSLFADLDPLSNPDAVGKTDKEHEL
LNA
NT seq 1452 nt   +upstreamnt  +downstreamnt
atgtcaggacacaaatgcagttatccctgggacttacaggatcgatatgctcaagataag
tcagttgtaaataagatgcaacagaaatattgggagacgaagcaggcctttattaaagcc
acagggaagaaggaagatgaacatgttgttgcctctgacgcggacctggatgccaagcta
gagctgtttcattcaattcagagaacctgtctggacttatcgaaagcaattgtactctat
caaaagaggatatgtttcttgtctcaagaagaaaatgaactgggaaaatttcttcgatcc
caaggtttccaagataaaaccagagcaggaaagatgatgcaagcgacaggaaaggccctc
tgcttttcttcccagcaaaggttggccttacgaaatcctttgtgtcgatttcaccaagaa
gtggagacttttcggcatcgggccatctcagatacttggctgacggtgaaccgcatggaa
cagtgcaggacggaatatagaggagcactattatggatgaaggacgtgtctcaggagctt
gatccagacctctacaagcaaatggagaagttcaggaaggtacaaacacaagtgcgcctt
ngcaaaaaaaactttgacaaattgaagatggatgtgtgtcaaaaagtggatcttcttgga
gcaagcagatgcaatctcttgtctcacatgctagcaacataccagaccactctgcttcat
ttttgggagaaaacttctcacactatggcagccatccatgagagtttcaaaggttatcaa
ccatatgaatttactactttaaagagcttacaagaccctatgaaaaaattagttgagaaa
gaagagaagaagaagatcacccagcaggaaagtacagatgcagccgtgcaggagccgagc
caattaatttcattagaggaagaaaaccagcgcaaggaatcctctagttttaagactgaa
gatggaaaaagtattttatctgccttagacaaaagctctacacatactgcatgctcagga
cccatagatgaactactagacatgaaatctgaggaaggtgcttgcctgggaccagtggca
gggaccccggaacctgaaggtgctgacaaagatgacctgctgctgttgaatgagatcttc
aatgcctcctccctggaagagggcgagttcagcaaagagtgggccgctgtgtttggagac
ggccaagtgaaggagccagtgcccactatggccctgggagagccagaccccaaggcccag
acaggctcaggtttccttccttcgcagcttttagaccaaaatatgaaagacttacaggcc
tcgctacaagaacctgctaaggctgcctcagacctgactgcctggttcagcctcttcgct
gacctcgacccactctcaaatcctgatgctgttgggaaaaccgataaagaacacgaattg
ctcaatgcatga

DBGET integrated database retrieval system