KEGG   Pan paniscus (bonobo): 100980204
Entry
100980204         CDS       T02283                                 

Gene name
MTOR
Definition
(RefSeq) mechanistic target of rapamycin
  KO
K07203  serine/threonine-protein kinase mTOR [EC:2.7.11.1]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps01521  EGFR tyrosine kinase inhibitor resistance
pps01522  Endocrine resistance
pps04012  ErbB signaling pathway
pps04066  HIF-1 signaling pathway
pps04072  Phospholipase D signaling pathway
pps04136  Autophagy - other
pps04140  Autophagy - animal
pps04150  mTOR signaling pathway
pps04151  PI3K-Akt signaling pathway
pps04152  AMPK signaling pathway
pps04211  Longevity regulating pathway
pps04213  Longevity regulating pathway - multiple species
pps04218  Cellular senescence
pps04371  Apelin signaling pathway
pps04630  JAK-STAT signaling pathway
pps04659  Th17 cell differentiation
pps04714  Thermogenesis
pps04910  Insulin signaling pathway
pps04919  Thyroid hormone signaling pathway
pps04920  Adipocytokine signaling pathway
pps04930  Type II diabetes mellitus
pps04931  Insulin resistance
pps04935  Growth hormone synthesis, secretion and action
pps05010  Alzheimer disease
pps05014  Amyotrophic lateral sclerosis
pps05016  Huntington disease
pps05017  Spinocerebellar ataxia
pps05022  Pathways of neurodegeneration - multiple diseases
pps05163  Human cytomegalovirus infection
pps05165  Human papillomavirus infection
pps05167  Kaposi sarcoma-associated herpesvirus infection
pps05168  Herpes simplex virus 1 infection
pps05170  Human immunodeficiency virus 1 infection
pps05200  Pathways in cancer
pps05205  Proteoglycans in cancer
pps05206  MicroRNAs in cancer
pps05210  Colorectal cancer
pps05212  Pancreatic cancer
pps05214  Glioma
pps05215  Prostate cancer
pps05221  Acute myeloid leukemia
pps05224  Breast cancer
pps05225  Hepatocellular carcinoma
pps05226  Gastric cancer
pps05230  Central carbon metabolism in cancer
pps05231  Choline metabolism in cancer
pps05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100980204 (MTOR)
   04371 Apelin signaling pathway
    100980204 (MTOR)
   04630 JAK-STAT signaling pathway
    100980204 (MTOR)
   04066 HIF-1 signaling pathway
    100980204 (MTOR)
   04072 Phospholipase D signaling pathway
    100980204 (MTOR)
   04151 PI3K-Akt signaling pathway
    100980204 (MTOR)
   04152 AMPK signaling pathway
    100980204 (MTOR)
   04150 mTOR signaling pathway
    100980204 (MTOR)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100980204 (MTOR)
   04136 Autophagy - other
    100980204 (MTOR)
  09143 Cell growth and death
   04218 Cellular senescence
    100980204 (MTOR)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    100980204 (MTOR)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100980204 (MTOR)
   04920 Adipocytokine signaling pathway
    100980204 (MTOR)
   04935 Growth hormone synthesis, secretion and action
    100980204 (MTOR)
   04919 Thyroid hormone signaling pathway
    100980204 (MTOR)
  09149 Aging
   04211 Longevity regulating pathway
    100980204 (MTOR)
   04213 Longevity regulating pathway - multiple species
    100980204 (MTOR)
  09159 Environmental adaptation
   04714 Thermogenesis
    100980204 (MTOR)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100980204 (MTOR)
   05206 MicroRNAs in cancer
    100980204 (MTOR)
   05205 Proteoglycans in cancer
    100980204 (MTOR)
   05230 Central carbon metabolism in cancer
    100980204 (MTOR)
   05231 Choline metabolism in cancer
    100980204 (MTOR)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100980204 (MTOR)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100980204 (MTOR)
   05212 Pancreatic cancer
    100980204 (MTOR)
   05225 Hepatocellular carcinoma
    100980204 (MTOR)
   05226 Gastric cancer
    100980204 (MTOR)
   05214 Glioma
    100980204 (MTOR)
   05221 Acute myeloid leukemia
    100980204 (MTOR)
   05215 Prostate cancer
    100980204 (MTOR)
   05224 Breast cancer
    100980204 (MTOR)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100980204 (MTOR)
   05014 Amyotrophic lateral sclerosis
    100980204 (MTOR)
   05016 Huntington disease
    100980204 (MTOR)
   05017 Spinocerebellar ataxia
    100980204 (MTOR)
   05022 Pathways of neurodegeneration - multiple diseases
    100980204 (MTOR)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100980204 (MTOR)
   04931 Insulin resistance
    100980204 (MTOR)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100980204 (MTOR)
   05168 Herpes simplex virus 1 infection
    100980204 (MTOR)
   05163 Human cytomegalovirus infection
    100980204 (MTOR)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100980204 (MTOR)
   05165 Human papillomavirus infection
    100980204 (MTOR)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100980204 (MTOR)
   01522 Endocrine resistance
    100980204 (MTOR)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pps01001]
    100980204 (MTOR)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pps04131]
    100980204 (MTOR)
Enzymes [BR:pps01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100980204 (MTOR)
Protein kinases [BR:pps01001]
 Serine/threonine kinases: Other
  PIKK family [OT]
   100980204 (MTOR)
Membrane trafficking [BR:pps04131]
 Autophagy
  Other autophagy associated proteins
   mTORC1 complex
    100980204 (MTOR)
SSDB
Motif
Pfam: FAT PI3_PI4_kinase DUF3385 FRB_dom FATC HEAT_2 UME V-ATPase_H_N EPSP_synthase HEAT_EZ Nipped-B_C
Other DBs
NCBI-GeneID: 100980204
NCBI-ProteinID: XP_003822131
UniProt: A0A2R9BI87
Position
1
AA seq 2549 aa
MLGTGPAAATTAATTSSNVSVLQQFASGLKSRNEETRAKAAKELQHYVTMELREMSQEES
TRFYDQLNHHIFELVSSSDANERKGGILAIASLIGVEGGNATRIGRFANYLRNLLPSSDP
VVMEMASKAIGRLAMAGDTFTAEYVEFEVKRALEWLGADRNEGRRHAAVLVLRELAISVP
TFFFQQVQPFFDNIFVAVWDPKQAIREGAVAALRACLILTTQREPKEMQKPQWYRHTFEE
AEKGFDETLAKEKGMNRDDRIHGALLILNELVRISSMEGERLREEMEEITQQQLVHDKYC
KDLMGFGTKPRHITPFTSFQAVQPQQSNALVGLLGYSSHQGLMGFGTSPSPAKSTLVESR
CCRDLMEEKFDQVCQWVLKCRNSKNSLIQMTILNLLPRLAAFRPSAFTDTQYLQDTMNHV
LSCVKKEKERTAAFQALGLLSVAVRSEFKVYLPRVLDIIRAALPPKDFAHKRQKAMQVDA
TVFTCISMLARAMGPGIQQDIKELLEPMLAVGLSPALTAVLYDLSRQIPQLKKDIQDGLL
KMLSLVLMHKPLRHPGMPKGLAHQLASPGLTTLPEASDVGSITLALRTLGSFEFEGHSLT
QFVRHCADHFLNSEHKEIRMEAARTCSRLLTPSIHLISGHAHVVSQTAVQVVADVLSKLL
VVGITDPDPDIRYCVLASLDERFDAHLAQAENLQALFVALNDQVFEIRELAICTVGRLSS
MNPAFVMPFLRKMLIQILTELEHSGIGRIKEQSARMLGHLVSNAPRLIRPYMEPILKALI
LKLKDPDPDPNPGVINNVLATIGELAQVSGLEMRKWVDELFIIIMDMLQDSSLLAKRQVA
LWTLGQLVASTGYVVEPYRKYPTLLEVLLNFLKTEQNQGTRREAIRVLGLLGALDPYKHK
VNIGMIDQSRDASAVSLSESKSSQDSSDYSTSEMLVNMGNLPLDEFYPAVSMVALMRIFR
DQSLSHHHTMVVQAITFIFKSLGLKCVQFLPQVMPTFLNVIRVCDGAIREFLFQQLGMLV
SFVKSHIRPYMDEIVTLMREFWVMNTSIQSTIILLIEQIVVALGGEFKLYLPQLIPHMLR
VFMHDNSPGRIVSIKLLAAIQLFGANLDDYLHLLLPPIVKLFDAPEAPLPSRKAALETVD
RLTESLDFTDYASRIIHPIVRTLDQSPELRSTAMDTLSSLVFQLGKKYQIFIPMVNKVLV
RHRINHQRYDVLICRIVKGYTLADEEEDPLIYQHRMLRSGQGDALASGPVETGPMKKLHV
STINLQKAWGAARRVSKDDWLEWLRRLSLELLKDSSSPSLRSCWALAQAYNPMARDLFNA
AFVSCWSELNEDQQDELIRSIELALTSQDIAEVTQTLLNLAEFMEHSDKGPLPLRDDNGI
VLLGERAAKCRAYAKALHYKELEFQKGPTPAILESLISINNKLQQPEAAAGVLEYAMKHF
GELEIQATWYEKLHEWEDALVAYDKKMDTNKDDPELMLGRMRCLEALGEWGQLHQQCCEK
WTLVNDETQAKMARMAAAAAWGLGQWDSMEEYTCMIPRDTHDGAFYRAVLALHQDLFSLA
QQCIDKARDLLDAELTAMAGESYSRAYGAMVSCHMLSELEEVIQYKLVPERREIIRQIWW
ERLQGCQRIVEDWQKILMVRSLVVSPHEDMRTWLKYASLCGKSGRLALAHKTLVLLLGVD
PSRQLDHPLPTVHPQVTYAYMKNMWKSARKIDAFQHMQHFVQTMQQQAQHAIATEDQQHK
QELHKLMARCFLKLGEWQLNLQGINESTIPKVLQYYSAATEHDRSWYKAWHAWAVMNFEA
VLHYKHQNQARDEKKKLRHASGANITNATTAATTAATATTTASTEGSNSESEAESTENSP
TPSPLQKKVTEDLSKTLLMYTVPAVQGFFRSISLSRGNNLQDTLRVLTLWFDYGHWPDVN
EALVEGVKAIQIDTWLQVIPQLIARIDTPRPLVGRLIHQLLTDIGRYHPQALIYPLTVAS
KSTTTARHNAANKILKNMCEHSNTLVQQAMMVSEELIRVAILWHEMWHEGLEEASRLYFG
ERNVKGMFEVLEPLHAMMERGPQTLKETSFNQAYGRDLMEAQEWCRKYMKSGNVKDLTQA
WDLYYHVFRRISKQLPQLTSLELQYVSPKLLMCRDLELAVPGTYDPNQPIIRIQSIAPSL
QVITSKQRPRKLTLMGSNGHEFVFLLKGHEDLRQDERVMQLFGLVNTLLANDPTSLRKNL
SIQRYAVIPLSTNSGLIGWVPHCDTLHALIRDYREKKKILLNIEHRIMLRMAPDYDHLTL
MQKVEVFEHAVNNTAGDDLAKLLWLKSPSSEVWFDRRTNYTRSLAVMSMVGYILGLGDRH
PSNLMLDRLSGKILHIDFGDCFEVAMTREKFPEKIPFRLTRMLTNAMEVTGLDGNYRITC
HTVMEVLREHKDSVMAVLEAFVYDPLLNWRLMDTNTKGNKRSRTRTDSYSAGQSVEILDG
VELGEPAHKKTGTTVPESIHSFIGDGLVKPEALNKKAIQIINRVRDKLTGRDFSHDDTLD
VPTQVELLIKQATSHENLCQCYIGWCPFW
NT seq 7650 nt   +upstreamnt  +downstreamnt
atgcttggaaccggacctgccgccgccaccaccgctgccaccacatctagcaatgtgagc
gtcctgcagcagtttgccagtggcctaaagagccggaatgaggaaaccagggccaaagcc
gccaaggagctccagcactatgtcactatggaactccgagagatgagtcaagaggagtct
actcgcttctatgaccaactgaaccatcacatttttgaattggtttccagctcagatgcc
aatgagaggaaaggtggcatcttggccatagctagcctcataggagtggaaggtgggaat
gccacccgaattggcagatttgccaactatcttcggaacctcctcccctccagtgaccca
gttgtcatggaaatggcatccaaggccattggccgtcttgccatggcaggggacactttt
accgctgagtacgtggaatttgaggtgaagcgagccctggaatggctgggtgctgaccgc
aatgagggccggagacatgcagctgtcctggttctccgtgagctggccatcagcgtccct
accttcttcttccagcaagtgcaacccttctttgacaacatttttgtggccgtgtgggac
cccaaacaggccatccgtgagggagctgtagccgcccttcgtgcctgtctgattctcaca
acccagcgtgagccgaaggagatgcagaagcctcagtggtacaggcacacatttgaagaa
gcagagaagggatttgatgagaccttggccaaagagaagggcatgaatcgggatgatcgg
atccatggagccttgctgatccttaacgagctggtccgaatcagcagcatggagggagag
cgtctgagagaagaaatggaagaaatcacacagcagcagctggtacacgacaagtactgc
aaagatctcatgggcttcggaacaaaacctcgtcacattacccccttcaccagtttccag
gctgtacagccccagcagtcaaatgccttggtggggctgctggggtacagctctcaccaa
ggcctcatgggatttgggacctcccccagtccagctaagtccaccctggtggagagccgg
tgttgcagagacttgatggaggagaaatttgatcaggtgtgccagtgggtgctgaaatgc
aggaatagcaagaactcgctgatccaaatgacaatccttaatttgttgccccgcttggct
gcattccgaccttctgccttcacagatacccagtatctccaagataccatgaaccatgtc
ctaagctgtgtcaagaaggagaaggaacgtacagcggccttccaagccctggggttactt
tccgtggctgtgaggtctgagtttaaggtctatttgcctcgcgtgctggacatcatccga
gcggccctgcccccaaaggacttcgcccataagaggcagaaggcaatgcaggtggacgcc
acagtcttcacttgcatcagcatgctggctcgagcaatggggccaggcatccagcaggat
atcaaggagctgctggagcccatgctggcagtgggactaagccctgccctcactgcagtg
ctctacgacctgagccgtcagattccacagctaaagaaggacattcaagatgggctactg
aaaatgctgtccctggtccttatgcacaaacccctccgccacccaggcatgcccaagggc
ctggcccatcagctggcctctcctggcctcacgaccctccctgaggccagcgatgtgggc
agcatcactcttgccctccgaacgcttggcagctttgaatttgaaggccactctctgacc
caatttgttcgccactgtgcggatcatttcctgaacagtgagcacaaggagatccgcatg
gaggctgcccgcacctgctcccgcctgctcacaccctccatccacctcatcagtggccat
gctcatgtggttagccagaccgcagtgcaagtggtggcagatgtgcttagcaaactgctc
gtagttgggataacagatcctgaccctgacattcgctattgtgtcttggcgtccctggac
gagcgctttgatgcacacctggcccaggcggagaacttgcaggccttgtttgtggctctg
aatgaccaggtgtttgagatccgggagctggccatctgcactgtgggccgactcagtagc
atgaaccctgcctttgtcatgcctttcctgcgcaagatgctcatccagattttgacagag
ttggagcacagtgggattggaagaatcaaagagcagagtgcccgcatgctggggcacctg
gtctccaatgccccccgactcatccgcccctacatggagcctattctgaaggcattaatt
ttgaaactgaaagatccagaccctgatccaaacccaggtgtgatcaataatgtcctagca
acaataggagaattggcacaggttagtggcctggaaatgaggaaatgggttgatgaactt
tttattatcatcatggacatgctccaggattcctctttgttggccaaaaggcaggtggct
ctgtggaccctgggacagttggtggccagcactggctatgtagtagagccctacaggaag
taccctactttgcttgaggtgctactgaattttctgaagactgagcagaaccagggtaca
cgcagagaggccatccgtgtgttagggcttttaggggctttggatccttacaagcacaaa
gtgaacattggcatgatagaccagtcccgggatgcctctgctgtcagcctgtcagaatcc
aagtcaagtcaggattcctctgactatagcactagtgaaatgctggtcaacatgggaaac
ttgcctctggatgagttctacccagctgtgtccatggtggccctgatgcggatcttccga
gaccagtcactctctcatcatcacaccatggttgtccaggccatcaccttcatcttcaag
tccctgggactcaaatgtgtgcagttcctgccccaggtcatgcccacgttccttaatgtc
attcgagtctgtgatggggccatccgggaatttttgttccagcagctgggaatgttggtg
tcctttgtgaagagccacatcagaccttatatggatgaaatagtcaccctcatgagagaa
ttctgggtcatgaacacctcaattcagagcacgatcattcttctcattgagcaaattgtg
gtagctcttgggggtgaatttaagctctacctgccccagctgatcccacacatgctgcgt
gtcttcatgcatgacaacagcccaggccgcattgtctctatcaagttactggctgcaatc
cagctgtttggcgccaacctggatgactacctgcatttactgctgcctcctattgttaag
ttgtttgatgcccctgaagctccactgccatctcgaaaggcagcgctagagactgtggac
cgcctgacggagtccctggatttcactgactatgcctcccggatcattcaccctattgtt
cgaacactggaccagagcccagaactgcgctccacagccatggacacgctgtcttcactt
gtttttcagctggggaagaagtaccaaattttcattccaatggtgaataaagttctggtg
cgacaccgaatcaatcatcagcgctatgatgtgctcatctgcagaattgtcaagggatac
acacttgctgatgaagaggaggatcctttgatttaccagcatcggatgcttaggagtggc
caaggggatgcattggctagtggaccagtggaaacaggacccatgaagaaactgcacgtc
agcaccatcaacctccaaaaggcctggggcgctgccaggagggtctccaaagatgactgg
ctggaatggctgagacggctgagcctggagctgctgaaggactcatcatcgccctccctg
cgctcctgctgggccctggcacaggcctacaacccgatggccagggatctcttcaatgct
gcatttgtgtcctgctggtctgaactgaatgaagatcaacaggatgagctcatcagaagc
atcgagttggccctcacctcacaagacatcgctgaagtcacacagaccctcttaaacttg
gctgaattcatggaacacagtgacaagggccccctgccactgagagatgacaatggcatt
gttctgctgggtgagagagctgccaagtgccgagcatatgccaaagcactacactacaaa
gaactggagttccagaaaggccccacccctgccattctagaatctctcatcagcattaat
aataagctacagcagccggaggcagcggccggagtgttagaatacgccatgaaacacttt
ggagagctggagatccaggctacctggtatgagaaactgcacgagtgggaggatgccctt
gtggcctatgacaagaaaatggacaccaacaaggacgacccagagctgatgctgggccgc
atgcgctgcctcgaggccttgggggaatggggtcaactccaccagcagtgctgtgaaaag
tggaccctggttaatgatgagacccaagccaagatggcccggatggctgctgcagctgca
tggggtttaggtcagtgggacagcatggaagaatacacctgtatgatccctcgggacacc
catgatggggcattttatagagctgtgctggcactgcatcaggacctcttctccttggca
caacagtgcattgacaaggccagggacctgctggatgctgaattaactgcgatggcagga
gagagttacagtcgggcatatggggccatggtttcttgccacatgctgtccgagctggag
gaggttatccagtacaaacttgtccccgagcgacgagagatcatccgccagatctggtgg
gagagactgcagggctgccagcgtatcgtagaggactggcagaaaatccttatggtgcgg
tcccttgtggtcagtcctcatgaagacatgagaacctggctcaagtatgcaagcctgtgc
ggcaagagtggcaggctggctcttgctcataaaactttagtgttgctcctgggagttgat
ccgtctcggcaacttgaccatcctctgccaacagttcaccctcaggtgacctatgcctac
atgaaaaacatgtggaagagtgcccgcaagatcgatgccttccagcacatgcagcatttt
gtccagaccatgcagcaacaggcccagcatgccatcgctactgaggaccagcagcataag
caggaactgcacaagctcatggcccgatgcttcctgaaacttggagagtggcagctgaat
ctacagggcatcaatgagagcacaatccccaaagtgctgcagtactacagcgccgccaca
gagcacgaccgcagctggtacaaggcctggcatgcgtgggcagtgatgaacttcgaagct
gtgctacactacaaacatcagaaccaagcccgcgatgagaagaagaaactgcgtcatgcc
agcggggccaacatcaccaacgccaccactgccgccaccacggccgccactgccaccacc
actgccagcaccgagggcagcaacagtgagagcgaggccgagagcaccgagaacagcccc
accccatcgccgctgcagaagaaggtcactgaggatctgtccaaaaccctcctgatgtac
acggtgcctgccgtccagggcttcttccgttccatctccttgtcacgaggcaacaacctc
caggatacactcagagttctcaccttatggtttgattatggtcactggccagatgtcaat
gaggccttagtggagggggtgaaagccatccagattgatacctggctacaggttatacct
cagctcattgcaagaattgatacgcccagacccttggtgggacgtctcattcaccagctt
ctcacagacattggtcggtaccacccccaggccctcatctacccgctgacagtggcttct
aagtctaccacgacagcccggcacaatgcagccaacaagattctgaagaacatgtgtgag
cacagcaacaccctggtccagcaggccatgatggtgagcgaggagctgatccgagtggcc
atcctctggcatgagatgtggcatgaaggcctggaagaggcatctcgtttgtactttggg
gaaaggaacgtgaaaggcatgtttgaggtgctggagcccttgcatgctatgatggaacgg
ggcccccagactctgaaggaaacatcctttaatcaggcctatggtcgagatttaatggag
gcccaagagtggtgcaggaagtacatgaaatcagggaatgtcaaggacctcacccaagcc
tgggacctctattatcatgtgttccgacgaatctcaaagcagctgcctcagctcacatcc
ttagagctgcaatatgtttccccaaaacttctgatgtgccgggaccttgaattggctgtg
ccaggaacatatgaccccaaccagccaatcattcgcattcagtccatagcaccgtctttg
caagtcatcacatccaagcagaggccccggaaattgacacttatgggcagcaacgggcat
gagtttgttttccttctaaaaggccatgaagatctgcgccaggatgagcgtgtgatgcag
ctcttcggcctggttaacacccttctggccaatgacccaacatctcttcggaaaaacctc
agcatccagagatatgctgtcatccctttatcgaccaactcgggcctcattggctgggtt
ccccactgtgacacactgcacgctctcatccgggactacagggagaagaagaagatcctt
ctcaacatcgagcatcgcatcatgttgcggatggctccggactatgaccacttgactctg
atgcagaaggtggaggtgtttgagcatgccgtcaataatacagctggggacgacctggcc
aagctgctgtggctgaaaagccccagctctgaggtgtggtttgaccgaagaaccaattat
acccgttctttagcggtcatgtcaatggttgggtatattttaggcctgggagatagacac
ccatccaacctgatgctggaccgtctgagtgggaagatcctgcacattgactttggggac
tgctttgaggttgctatgacccgagagaagtttccagagaagattccatttagactaaca
agaatgttgaccaatgctatggaggttacaggcctggatggcaactacagaatcacatgc
cacacagtgatggaggtgctgcgagagcacaaggacagtgtcatggccgtgctggaagcc
tttgtctatgaccccttgctgaactggaggctgatggacacaaatacgaaaggcaacaag
cgatcccgaacgaggacggattcctactctgctggccagtcagtcgaaattttggacggt
gtggaacttggagagccagcccataagaaaacggggaccacagtgccagaatctattcat
tctttcattggagacggtttggtgaaaccagaggccctaaataagaaagctatccagatt
attaacagggttcgagataagctcactggtcgggacttctctcatgatgacactttggat
gttccaacgcaagttgagctgctcatcaaacaagcgacatcccatgaaaacctctgccag
tgctatattggctggtgccctttctggtaa

DBGET integrated database retrieval system