KEGG   Pan paniscus (bonobo): 100980205Help
Entry
100980205         CDS       T02283                                 

Gene name
CCNDBP1
Definition
(RefSeq) cyclin D1 binding protein 1
  KO
K21626  cyclin-D1-binding protein 1
Organism
pps  Pan paniscus (bonobo)
Brite
KEGG Orthology (KO) [BR:pps00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pps03000]
    100980205 (CCNDBP1)
Transcription factors [BR:pps03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   HLH domain only
    100980205 (CCNDBP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GCIP DUF5368
Motif
Other DBs
NCBI-GeneID: 100980205
NCBI-ProteinID: XP_003805643
UniProt: A0A2R9B143
Position
15
AA seq 360 aa AA seqDB search
MASATAPAAAVPTLASPLEQLRYLAEELRLLLPRVRVGEAQETTEEFNREMFWRRLNEAA
VTVSREATTLTTVFSQLPLPSPQETQKFCEQVHAAIKAFIAVYYLLPKDQGITLRKLVRG
ATLDIVDGMAQLMEVLSVTPTQSPENNDLISYNSVWVACQQMPQIPRDNKAAALLMLTKN
VDFVKDAHEEMEQAVEECDPYSGLLNDTEENNSDNHNHEDDVLGFPSNQDLYWSEDDQEL
IIPCLALVRASKACLKKIRMLVAENGKKDQVAQLDDIVDISDEISPSVDDLALSIYPPMC
HLTVRINSAKLVSVLKKALEITKASHVTPQPEDSWIPLLINAIDHCLNRIKELTQSELEL
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atggcgagcgcaactgcacctgcagccgcagtccccaccctggcttcgcctttggagcag
ctccggtacttggcggaggagctgcggttgctcctgcctcgagtgcgggtcggcgaagcc
caggagaccaccgaggagtttaatcgagagatgttctggagaagactcaatgaggcagct
gtgactgtgtcaagggaagccacgactctgaccacagtcttctctcagcttccactgccg
tctccacaggaaacccagaagttctgtgaacaagtccatgctgccatcaaggcatttatt
gcagtgtactatttgcttccaaaggatcaggggatcaccctgagaaagctggtacggggc
gccaccctggacatcgtggatggcatggctcagctcatggaagtactttccgtcactcca
actcagagccctgagaacaatgaccttatttcctacaacagtgtctgggttgcatgccag
cagatgcctcagataccaagagataacaaagctgcagctcttttgatgctgaccaagaat
gtggattttgtgaaggatgcacatgaagaaatggagcaggctgtggaagaatgtgaccct
tactctggcctcttgaatgatactgaggagaacaactctgacaaccacaatcatgaggat
gatgtgttggggtttcccagcaatcaggacttgtattggtcagaggacgatcaagagctc
ataatcccatgccttgcgctggtgagagcatccaaagcctgcctgaagaaaattcggatg
ttagtggcagagaatgggaagaaggatcaggtggcacagctggatgacattgtggatatt
tctgatgaaatcagccctagtgtggatgatttggctctgagcatatatccacctatgtgt
cacctgaccgtgcgaatcaattctgcgaaacttgtatctgttttaaagaaggcacttgaa
attacaaaagcaagtcatgtgacccctcagccagaagatagttggatccctttacttatt
aatgccattgatcattgcttgaatagaatcaaggagctcactcagagtgaacttgaatta
tga

DBGET integrated database retrieval system