KEGG   Pan paniscus (bonobo): 100980401Help
Entry
100980401         CDS       T02283                                 

Gene name
TMED6
Definition
(RefSeq) transmembrane p24 trafficking protein 6
  KO
K20351  p24 family protein gamma-5
Organism
pps  Pan paniscus (bonobo)
Brite
KEGG Orthology (KO) [BR:pps00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pps04131]
    100980401 (TMED6)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pps02000]
    100980401 (TMED6)
Membrane trafficking [BR:pps04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   p24 family proteins
    100980401 (TMED6)
Transporters [BR:pps02000]
 Other transporters
  Others
   100980401 (TMED6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EMP24_GP25L
Motif
Other DBs
NCBI-GeneID: 100980401
NCBI-ProteinID: XP_003814604
UniProt: A0A2R8ZY15
Position
16
AA seq 240 aa AA seqDB search
MSPLLFGAGLVVLNLVTSARSQKTEPLSGSGDQPLFRGADRYDFAIMIPPGGTECFWQFA
HQTGYFYFSYEVQRTVGMSHDRHVAATAHNPQGFLIDTFQGVRGQINFSTQETGFYQLCL
SNQHNHFGSVQVYLNFGVFYEGPETDHKQKERKQLNDTLDAIEDGTQKVQNNIFHMWRYY
NFARMRKMADFFLIQSNYNYVNWWSTAQSLVIILSGILQLYFLKRLFNVPTTTDTKKPGC
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgtcccctttgctctttggggctgggctggtcgttctgaatctagtgacgtctgccagg
agccagaagacagaacctctaagtggctctggggaccagccactcttccgtggagctgat
cgatatgactttgccatcatgatacctccaggaggcacggaatgcttttggcaatttgcc
caccagactggatacttctatttcagttacgaggttcagcggacagtggggatgtcacat
gaccggcatgttgctgccacggcacataacccacagggatttctcatagacaccttccag
ggtgttcggggccagattaacttctctacccaagagacaggtttttatcagctttgtcta
agtaatcagcataatcacttcggttctgtgcaagtgtacctcaactttggagtcttctat
gaggggcctgagactgatcacaaacagaaggaaagaaaacaactgaatgatactctggat
gcaattgaggacggcacacaaaaggtgcagaacaatatctttcacatgtggcgatactac
aactttgcccggatgaggaaaatggctgactttttccttatccaatcaaactataactac
gtgaactggtggtcgacagcccagagcctcgttattattctttctgggatcctgcaactg
tatttcttgaagcgtctcttcaatgttccaacaactacagatacaaagaagccaggatgc
taa

DBGET integrated database retrieval system