KEGG   Pan paniscus (bonobo): 100980540Help
Entry
100980540         CDS       T02283                                 

Gene name
CARD11
Definition
(RefSeq) caspase recruitment domain family member 11
  KO
K07367  caspase recruitment domain-containing protein 11
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04064  NF-kappa B signaling pathway
pps04660  T cell receptor signaling pathway
pps04662  B cell receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    100980540 (CARD11)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    100980540 (CARD11)
   04662 B cell receptor signaling pathway
    100980540 (CARD11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CARD PDZ Guanylate_kin PDZ_6
Motif
Other DBs
NCBI-GeneID: 100980540
NCBI-ProteinID: XP_003819797
UniProt: A0A2R9B2K9
Position
7
AA seq 1154 aa AA seqDB search
MPGGGPEMDDYMETLKDEEDALWENVECNRHMLSRYINPAKLTPYLRQCKVIDEQDEDEV
LNAPMLPSKINRAGRLLDILHTKGQRGYVVFLESLEFYYPELYKLVTGKEPTRRFSTIVV
EEGHEGLTHFLMNEVIKLQQQMKAKDLQRCELLARLRQLEDEKKQMTLTRVELLTFQERY
YKMKEERDSYNDELVKVKDDNYNLAMRYAQLSEEKNMAVMRSRDLQLEIDQLKHRLNKME
EECKLERNQSLKLKNDIENRPKKEQVLELERENEMLKTKNQELQSIIQAGKRSLPDSDKA
ILDILEHDRKEALEDRQELVNRIYNLQEEARQAEELRDKYLEEKEDLELKCSTLGKDCEM
YKHRMNTVMLQLEEVERERDQAFHSRDEAQTQYSQCLIEKDKYRKQIRELEEKNDEMRIE
MVRREACIVNLESKLRRLSKDSNNLDQSLPRNLPVTIISQDFGDASPRTNGQEADDSSTS
EESPEDSKYFLPYHPPQRRMNLKGIQLQRAKSPISLKRTSDFQAKGHEEEGTDASPSSCG
SLPITNSFTKMQPPRSRSSIMSITAEPPGNDSIVRRYKEDAPHRSTVEEDNDSGGFDALD
LDDDSHERYSFGPSSVHSSSSSHQSEGLDAYDLEQVNLMFRKFSLERPFRPSVTSVGHVR
GPGPSVQHTTLNGDSLTSQLTLLGGNARGSFVHSVKPGSLAEKAGLREGHQLLLLEGCIR
GERQSVPLDTCTKEEAHWTIQRCSGPVTLHYKVNHEGYRKLVKDMEDGLITSGDSFYIRL
NLNISSQLDACTMSLKCDDVVHVRDTMYQDRHEWLCARVDPFTDHDLDMGTIPSYSRAQQ
LLLVKLQRLMHRGSREEVDGTHHTLRALRNTLQPEEALSTSDPRVSPRLSRASFLFGQLL
QFVSRSENKYKRMNSNERVRIISGSPLGSLARSSLDATKLLTEKQEELDPESELGKNLSL
IPYSLVRAFYCERRRPVLFTPTVLAKTLVQRLLNSGGAMEFTICKSDIVTRDEFLRRQKT
ETIIYSREKNPNAFECIAPANIEAVAAKNKHCLLEAGIGCTRDLIKSNIYPIVLFIRVCE
KNIKRFRKLLPRPETEEEFLRVCRLKEKELEALPCLYATVEPDMWGSVEELLRVVKDKIG
EEQRKTIWVDEDQL
NT seq 3465 nt NT seq  +upstreamnt  +downstreamnt
atgccaggaggagggccagagatggatgactacatggagacgctgaaggatgaagaggac
gccttgtgggagaatgtggagtgtaaccggcacatgctcagccgctatatcaaccctgcc
aagctcacgccctacctgcgtcagtgtaaggtcattgatgagcaggatgaagatgaagtg
cttaatgcccctatgctgccatccaagatcaaccgagcaggccggctgttggacattcta
cataccaaggggcaaaggggctatgtggtcttcttggagagcctagaattttattaccca
gagctgtacaaactggtgactgggaaagagcccactcggagattctccaccattgtggtg
gaggaaggccacgagggcctcacgcacttcctgatgaacgaggtcatcaagctgcagcag
cagatgaaggccaaggacctgcaacgctgcgagctgctggccaggttgcggcagctggag
gatgagaagaagcagatgacgctgacgcgcgtggagctgctaaccttccaggagcggtac
tacaagatgaaggaagagcgggacagctacaatgacgagctggtcaaggtgaaggacgac
aactacaacttagccatgcgctacgcacagctcagtgaggagaagaacatggcagtcatg
aggagccgagacctccaactcgagatcgatcagctaaagcaccggttgaataagatggag
gaggaatgtaagctggagagaaatcagtctctgaaactgaagaatgacattgaaaatcgg
cccaagaaggagcaggttctggaactggagcgggagaatgaaatgctgaagaccaaaaac
caggagctgcagtccatcatccaggccgggaagcgcagcctgccagactcagacaaggcc
atcctggacatcttggaacacgaccgcaaggaggccctggaggacaggcaggagctggtc
aacaggatctacaacctgcaggaggaggcccgccaggcagaggagctgcgagacaagtac
ctggaggagaaggaggacctggaactcaagtgctcgaccctggggaaggactgtgaaatg
tacaagcaccgcatgaacacggtcatgctgcagctggaggaggtggagcgggagcgggac
caggccttccactcccgagatgaagctcagacgcagtactcgcagtgcttaatcgaaaag
gacaagtacaggaagcagatccgcgagctggaggagaagaacgacgagatgaggattgag
atggtgcggcgggaggcctgcatcgtcaacctggagagcaagctgcggcgcctctccaag
gacagcaacaacctggaccagagtctgcccaggaacctgccagtaaccatcatctctcag
gactttggggacgccagccccaggaccaatggtcaagaagctgacgattcttccacctcg
gaggagtcacctgaagacagcaagtacttcctgccctaccatccgccccagcgcaggatg
aacctgaagggcatccagctgcagagagccaaatcccccatcagcctgaagcgaacatca
gattttcaagccaaggggcacgaggaagaaggcacggacgccagccccagctcctgcgga
tctctgcccatcaccaactccttcaccaagatgcagcccccacggagccgcagcagcatc
atgtcaatcaccgccgagcccccgggaaacgactccatcgtcagacgctacaaggaggac
gcgccccatcgcagcacagtcgaagaagacaatgacagcggcgggtttgacgccttagat
ctggatgatgacagtcacgaacgctactccttcggaccctcctccgttcactcctcctcc
tcctcccaccaatccgagggcctggatgcctacgacctggagcaggtcaacctcatgttc
aggaagttctctctggaaagacccttccggccttcagtcacttctgtggggcacgtgcgg
ggcccagggccctcggtgcagcacacgacgctgaatggcgacagcctcacctcccagctc
accctgctggggggcaacgcgcgagggagcttcgtgcactcggtcaagcctggctctctg
gccgagaaagccggcctccgtgagggccaccagctgctgctgctagaaggctgcatccga
ggcgagaggcagagtgtcccgttggacacatgcaccaaagaggaagcccactggaccatc
cagaggtgcagcggccccgtcacgctgcactacaaggtcaaccacgaagggtaccggaag
ctggtgaaggacatggaggatggcctgatcacatcgggggactcgttctacatccggctg
aacctgaacatctccagccagctggacgcctgcaccatgtccctgaagtgtgacgatgtt
gtgcacgtccgtgacaccatgtaccaggacaggcacgagtggctgtgcgcgcgggtcgac
cctttcacagaccatgacctggatatgggcaccatacccagctacagccgagcccagcag
ctcctcctggtcaaactgcaacgcctgatgcaccgaggcagccgggaggaggtggacggc
acccaccacaccctgcgggcactccggaacaccctgcagccggaagaagcgctttcaaca
agcgaccctcgggtcagcccccgtctctcgcgagcaagcttcctttttggccagctcctt
cagttcgtcagcaggtccgagaacaagtataagcggatgaacagcaacgagcgggtccgc
atcatctcggggagtccgctagggagcctggcccggtcctcgctggacgccaccaagctc
ttgactgagaagcaggaagagctggaccctgagagcgagctgggcaagaacctcagcctc
atcccctacagcctggtacgcgccttctactgcgagcgccgccggcccgtgctcttcacg
cccaccgtgctggccaagacgctggtgcagaggctgctcaactcgggaggtgccatggag
ttcaccatctgcaagtcagatatcgtcacaagagatgagttcctcagaaggcagaagacg
gagaccatcatctactcccgagagaagaaccccaacgcgttcgaatgcatcgcccctgcc
aacatcgaagctgtggccgccaagaacaagcactgcctgctggaggctgggatcggctgc
acgagagacttgatcaagtccaacatctaccccatcgtgctcttcatccgggtgtgtgag
aagaacatcaagaggttcagaaagctgctgccccggcctgagacggaggaggagttcctg
cgcgtgtgccggctgaaggagaaggagctggaggccctgccgtgcctgtacgccacggtg
gaacctgacatgtggggcagcgtagaggagctgctccgcgttgtcaaggacaagatcggc
gaggagcagcgcaagaccatctgggtggacgaggaccagctgtga

DBGET integrated database retrieval system