KEGG   Pan paniscus (bonobo): 100980644Help
Entry
100980644         CDS       T02283                                 

Gene name
TLR4
Definition
(RefSeq) toll like receptor 4
  KO
K10160  toll-like receptor 4
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04064  NF-kappa B signaling pathway
pps04066  HIF-1 signaling pathway
pps04145  Phagosome
pps04151  PI3K-Akt signaling pathway
pps04217  Necroptosis
pps04620  Toll-like receptor signaling pathway
pps04621  NOD-like receptor signaling pathway
pps05132  Salmonella infection
pps05133  Pertussis
pps05134  Legionellosis
pps05140  Leishmaniasis
pps05142  Chagas disease (American trypanosomiasis)
pps05144  Malaria
pps05145  Toxoplasmosis
pps05146  Amoebiasis
pps05152  Tuberculosis
pps05161  Hepatitis B
pps05162  Measles
pps05164  Influenza A
pps05170  Human immunodeficiency virus 1 infection
pps05205  Proteoglycans in cancer
pps05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
pps05321  Inflammatory bowel disease (IBD)
pps05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    100980644 (TLR4)
   04066 HIF-1 signaling pathway
    100980644 (TLR4)
   04151 PI3K-Akt signaling pathway
    100980644 (TLR4)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100980644 (TLR4)
  09143 Cell growth and death
   04217 Necroptosis
    100980644 (TLR4)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100980644 (TLR4)
   04621 NOD-like receptor signaling pathway
    100980644 (TLR4)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    100980644 (TLR4)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100980644 (TLR4)
  09163 Immune disease
   05323 Rheumatoid arthritis
    100980644 (TLR4)
   05321 Inflammatory bowel disease (IBD)
    100980644 (TLR4)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100980644 (TLR4)
   05135 Yersinia infection
    100980644 (TLR4)
   05133 Pertussis
    100980644 (TLR4)
   05134 Legionellosis
    100980644 (TLR4)
   05152 Tuberculosis
    100980644 (TLR4)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100980644 (TLR4)
   05162 Measles
    100980644 (TLR4)
   05164 Influenza A
    100980644 (TLR4)
   05161 Hepatitis B
    100980644 (TLR4)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100980644 (TLR4)
   05144 Malaria
    100980644 (TLR4)
   05145 Toxoplasmosis
    100980644 (TLR4)
   05140 Leishmaniasis
    100980644 (TLR4)
   05142 Chagas disease (American trypanosomiasis)
    100980644 (TLR4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pps04131]
    100980644 (TLR4)
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:pps04054]
    100980644 (TLR4)
   04090 CD molecules [BR:pps04090]
    100980644 (TLR4)
   00536 Glycosaminoglycan binding proteins [BR:pps00536]
    100980644 (TLR4)
Membrane trafficking [BR:pps04131]
 Endocytosis
  Phagocytosis
   Toll-like receptors
    100980644 (TLR4)
Pattern recognition receptors [BR:pps04054]
 Membrane-bound pattern recognition receptors
  Toll-like receptors
   100980644 (TLR4)
CD molecules [BR:pps04090]
 Proteins
  100980644 (TLR4)
Glycosaminoglycan binding proteins [BR:pps00536]
 Hyaluronan
  Cell surface receptors
   100980644 (TLR4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: LRR_8 TIR LRR_4 TIR_2 LRR_9 LRR_1 LRR_6 DUF1863 Curto_V2
Motif
Other DBs
NCBI-GeneID: 100980644
NCBI-ProteinID: NP_001266152
UniProt: B3Y628
Position
9
AA seq 839 aa AA seqDB search
MMSASRLAGTLIPAMAFLSCVRPESWEPCVEVVPNITYQCMELNFYKIPDNLPFSTKNLD
LSFNPLRHLGSYSFFSFPELQVLDLSRCEIQTIEDGAYQSLSHLSTLILTGNPIQSLALG
AFSGLSSLQKLVAVETNLASLENFPIGHLKTLKELNVAHNLIQSFKLPEYFSNLTNLEHL
DLSSNKIQSIYCTDLRVLHQMPLLNLSLDLSLNPMNFIQPGAFKEIRLHKLTLRNNFDSL
NVMKTCIQGLAGLEVHRLVLGEFRNEENLEKFDKSALEGLCNLTIEEFRLAYLDYYLDDI
IDLFNCLTNVSSFSLVSVTIKSVKDFSYNFGWQHLELVKCKFGQFPTLKLKSLKRLTFTS
NKGGNAFSEVDLPSLEFLDLSRNGLSFKGCCSQSDFGTTSLKYLDLSFNGVITMSSNFLG
LEQLEHLDFQHSNLKQMSEFSVFLSLRNLIYLDISHTHTRVAFNGIFNGLSSLEVLKMAG
NSFQENFLPDIFTELRNLTFLDLSQCQLEQLSPTAFNSLSSLQVLNMSHNNFFSLDTFPY
KCLNSLQVLDYSLNHIMTSKKQELQHFPSSLAFLNLTQNDFACTCEHQSFLQWIKDQRQL
LVEVERMECATPSDKQGMPVLSLNITCQMNKTIIGVSVLSVLVVSVVAVLVYKFYFHLML
LAGCIKYGRGENIYDAFVIYSSQDEDWVRNELVKNLEEGVPPFQLCLHYRDFIPGVAIAA
NIIHEGFHKSRKVIVVVSQHFIQSRWCIFEYEIAQTWQFLSSRAGIIFIVLQKVEKTLLR
RQVELYRLLSRNTYLEWEDSVLGRHIFWRRLRKALLDGKSWNPEGTVGTGCNWQEATSI
NT seq 2520 nt NT seq  +upstreamnt  +downstreamnt
atgatgtctgcctcgcgcctggctgggactctgatcccagccatggccttcctctcctgc
gtgagaccagaaagctgggagccctgcgtggaggtggttcctaatattacttatcaatgc
atggagctgaatttctacaaaatccccgacaacctccccttctcaaccaagaacctggac
ctgagctttaatcccctgaggcatttaggcagctatagcttcttcagtttcccagaactg
caggtgctggatttatccaggtgtgaaatccagacaattgaagatggggcatatcagagc
ctaagccacctctccaccttaatattgacaggaaaccccatccagagtttagccctggga
gccttttctggactatcaagtttacagaagctggtggctgtggagacaaatctagcatct
ctagagaacttccccattggacatctcaaaactttgaaagaacttaatgtggctcacaat
cttatccaatctttcaaattacctgagtatttttctaatctgaccaatctagagcacttg
gacctttccagcaacaagattcaaagtatttattgcacagacttgcgggttctacatcaa
atgcccctactcaatctctctttagacctgtccctgaaccctatgaactttatccaacca
ggtgcatttaaagaaattaggcttcataagctgactttgagaaataattttgatagttta
aatgtaatgaaaacttgtattcaaggtctggctggtttagaagtccatcgtttggttctg
ggagaatttagaaatgaagaaaacttggaaaagtttgacaaatctgctctagagggcctg
tgcaatttgaccattgaagaattccgattagcatacttagactactacctcgatgatatt
attgacttatttaattgtttgacaaatgtttcttcattttccctggtgagtgtgactatt
aaaagcgtaaaagacttttcttataatttcggatggcaacatttagaattagttaagtgt
aaatttggacagtttcccacattgaaactcaaatctctcaaaaggcttactttcacttcc
aacaaaggtgggaatgctttttcagaagttgatctaccaagccttgagtttctagatctc
agtagaaatggcttgagtttcaaaggttgctgttctcaaagtgattttgggacaaccagc
ctaaagtatttagatctgagcttcaatggtgttattaccatgagttcaaacttcttgggc
ttagaacaactagaacatctggatttccagcattccaatttgaaacaaatgagtgagttt
tcagtattcctatcactcagaaacctcatttaccttgacatttctcatactcacaccaga
gttgctttcaatggcatcttcaatggcttgtccagtctcgaagtcttgaaaatggctggc
aattctttccaggaaaacttccttccagatatcttcacagagctgagaaacttgaccttc
ctggacctctctcagtgtcaactggagcagttgtctccaacagcatttaactcactctcc
agtcttcaggtactaaatatgagccacaacaacttcttttcattggatacgtttccttat
aagtgtctgaactccctccaggttcttgattacagtctcaatcacataatgacttccaaa
aaacaggaactacagcattttccaagtagtctagctttcttaaatcttactcagaatgac
tttgcttgtacttgtgaacaccaaagtttcctgcaatggatcaaggaccagaggcagctc
ttggtggaagttgaacgaatggaatgtgcaacaccttcagataagcagggcatgcctgtg
ctgagtttgaatatcacctgtcagatgaataagaccatcattggtgtgtcggtcctcagt
gtgcttgtagtatctgttgtagcagttctggtctataagttctattttcacctgatgctt
cttgctggctgcataaagtatggtagaggtgaaaacatctatgatgcctttgttatctac
tcaagccaggatgaggactgggtaaggaatgagctagtaaagaatttagaagaaggggtg
cctccatttcagctctgccttcactacagagactttattcccggtgtggccattgctgcc
aacatcatccatgaaggtttccataaaagccgaaaggtgattgttgtggtgtcccagcac
ttcatccagagccgctggtgtatctttgaatatgagattgctcagacgtggcagtttctg
agcagtcgtgctggtatcatcttcattgtcctgcagaaggtggagaagaccctgctcagg
cggcaggtggagctgtaccgccttctcagcaggaacacttacctggagtgggaggacagt
gtcctggggcggcacatcttctggagacgactcagaaaagccctgctggatggtaaatca
tggaatccagaaggaacagtgggtacaggatgcaattggcaggaagcaacatctatctga

DBGET integrated database retrieval system