KEGG   Pan paniscus (bonobo): 100980681Help
Entry
100980681         CDS       T02283                                 

Gene name
CFAP97
Definition
(RefSeq) cilia and flagella associated protein 97
Organism
pps  Pan paniscus (bonobo)
SSDB OrthologParalogGFIT
Motif
Pfam: KIAA1430
Motif
Other DBs
NCBI-GeneID: 100980681
NCBI-ProteinID: XP_008975377
UniProt: A0A2R9A6I1
Position
4
AA seq 529 aa AA seqDB search
MDQFGDILEGEVDHSFFDSDFEEGKKCETHSVFDKQNDDPKERIDKDTKNVNSNTGMQTA
ENYLTEKGNERNVKFPPEHPVENDVTQTVSSFSLPASSRSKKLCDVTTGLKIHVSIPNRI
PKIVEEGEDDYYTDGEESSDDGKKYHVQSKSTKPSTNVKKSTRKKYRKVSSSSSSLSSSS
SGSATDGLDAGSDSHLSDSSPSSKKHASGITLLSPKQKYQSGIKSTETQPSSTTPKCGHY
PEESEDTVTDVSPLSTPDISPLQSFELGIANDQKVKIKKQENVSQEIYEDVEDLKNNSKY
LKAAKKGKEKHEPDVSSKLSSVSDSSLDHRHKQKVLHDTMDLNHLLKAFLQLDKKGPQKH
HFDQPSVAPGKNYSFTREEVRQIDRENQRLLKELSRQAEKPGSKSTIPRSADHPPKLYHS
ALNRQKEQQRIERENLALLKRLEAVKPTVGMKRSEQLMDYHRNMGYLNSSPLSRRARSTL
GQYSPLRGASRTSSATSGLSCRSERPAVDPSSGHPRRRPKPPNVRTAWL
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atggatcagtttggagatatattagaaggtgaagtggaccattctttctttgacagtgac
tttgaagaaggaaagaaatgtgaaactcactcagtttttgacaagcaaaatgatgaccca
aaggaaagaatagataaagatacaaaaaatgtaaattcgaacactggaatgcaaacagca
gaaaattatcttactgagaagggaaatgaaagaaacgtgaaatttcccccggaacaccct
gtagagaatgatgttacacaaactgtaagttctttctcattgccagcctcttcaagatca
aaaaaattgtgtgatgttacaacaggacttaaaatacacgtatccattccaaatagaatt
cccaaaattgtagaagaaggtgaagatgattactacacagatggagaggaaagcagtgat
gatgggaagaaataccatgtgcagtccaagtccactaaaccgtctactaacgttaaaaaa
agcacgaggaaaaagtatcgcaaagttagctcctcctcctcctctttatcttcctcatct
tcaggttcagctacagatggtttagatgcagggtctgatagccatctatctgattcgtct
ccgtcatccaagaaacatgcgtctggtataaccctcctgtcaccaaaacagaagtatcaa
tcaggaataaaatcgacagaaacacagccttcaagtactacaccaaaatgtggccactac
cctgaggagtctgaagatactgtgaccgacgtaagtcccttatcaactccagacattagc
cctcttcagtcttttgaactgggcatagcaaatgatcaaaaagtgaaaattaaaaagcaa
gaaaatgtgagccaagaaatatatgaagatgttgaggatttgaaaaataattcaaaatat
ttgaaagcagccaaaaaagggaaagaaaaacatgagcctgatgtctcctcaaagttgtct
tcagtgtcagactccagtttagaccacagacataaacagaaagtcttacatgacacaatg
gatctgaatcatctcttgaaagcttttctgcaattagataaaaaaggaccacaaaaacat
cactttgatcagccttcagtagcacccgggaaaaactactctttcacaagagaagaggtg
agacagatcgatcgggaaaatcagaggcttttgaaagaactgtcaagacaggcggaaaag
ccaggaagcaaaagtacaattcctagatcggctgatcatcccccaaagttatatcacagt
gctctcaacagacagaaggaacaacaaaggattgagagagaaaacttggctttattgaaa
aggcttgaggccgtgaaaccaacagttggtatgaaacgctcagaacaactgatggactat
catcgcaatatgggctatctcaactcatcaccattgtcaagacgggccagatccactctt
ggccaatatagcccattaagaggcgcttccaggacctccagtgctacgagtggcctcagc
tgtaggagtgagcgaccagcggttgacccctccagtggccaccctcgaagaagacctaaa
ccccctaatgtccgtacagcttggttataa

DBGET integrated database retrieval system