KEGG   Pan paniscus (bonobo): 100980706
Entry
100980706         CDS       T02283                                 

Gene name
SMAD2
Definition
(RefSeq) SMAD family member 2
  KO
K04500  mothers against decapentaplegic homolog 2
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04110  Cell cycle
pps04144  Endocytosis
pps04218  Cellular senescence
pps04350  TGF-beta signaling pathway
pps04371  Apelin signaling pathway
pps04390  Hippo signaling pathway
pps04550  Signaling pathways regulating pluripotency of stem cells
pps04659  Th17 cell differentiation
pps04926  Relaxin signaling pathway
pps04933  AGE-RAGE signaling pathway in diabetic complications
pps05142  Chagas disease
pps05166  Human T-cell leukemia virus 1 infection
pps05200  Pathways in cancer
pps05205  Proteoglycans in cancer
pps05210  Colorectal cancer
pps05212  Pancreatic cancer
pps05225  Hepatocellular carcinoma
pps05226  Gastric cancer
pps05321  Inflammatory bowel disease
pps05415  Diabetic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    100980706 (SMAD2)
   04390 Hippo signaling pathway
    100980706 (SMAD2)
   04371 Apelin signaling pathway
    100980706 (SMAD2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100980706 (SMAD2)
  09143 Cell growth and death
   04110 Cell cycle
    100980706 (SMAD2)
   04218 Cellular senescence
    100980706 (SMAD2)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100980706 (SMAD2)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    100980706 (SMAD2)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    100980706 (SMAD2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100980706 (SMAD2)
   05205 Proteoglycans in cancer
    100980706 (SMAD2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100980706 (SMAD2)
   05212 Pancreatic cancer
    100980706 (SMAD2)
   05225 Hepatocellular carcinoma
    100980706 (SMAD2)
   05226 Gastric cancer
    100980706 (SMAD2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100980706 (SMAD2)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    100980706 (SMAD2)
  09163 Immune disease
   05321 Inflammatory bowel disease
    100980706 (SMAD2)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    100980706 (SMAD2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100980706 (SMAD2)
SSDB
Motif
Pfam: MH2 MH1 IRF-3
Other DBs
NCBI-GeneID: 100980706
NCBI-ProteinID: XP_003827247
UniProt: A0A2R9B4S1
Position
18
AA seq 467 aa
MSSILPFTPPVVKRLLGWKKSAGGSGGAGGGEQNGQEEKWCEKAVKSLVKKLKKTGRLDE
LEKAITTQNCNTKCVTIPSTCSEIWGLSTPNTIDQWDTTGLYSFSEQTRSLDGRLQVSHR
KGLPHVIYCRLWRWPDLHSHHELKAIENCEYAFNLKKDEVCVNPYHYQRVETPVLPPVLV
PRHTEILTELPPLDDYTHSIPENTNFPAGIEPQSNYIPETPPPGYISEDGETSDQQLNQS
MDTGSPAELSPTTLSPVNHSLDLQPVTYSEPAFWCSIAYYELNQRVGETFHASQPSLTVD
GFTDPSNSERFCLGLLSNVNRNATVEMTRRHIGRGVRLYYIGGEVFAECLSDSAIFVQSP
NCNQRYGWHPATVCKIPPGCNLKIFNNQEFAALLAQSVNQGFEAVYQLTRMCTIRMSFVK
GWGAEYRRQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSVRCSSMS
NT seq 1404 nt   +upstreamnt  +downstreamnt
atgtcgtccatcttgccattcacgccgccagttgtgaagagactgctgggatggaagaag
tcagctggtgggtctggaggagcaggcggaggagagcagaatgggcaggaagaaaagtgg
tgtgagaaagcagtgaaaagtctggtgaagaagctaaagaaaacaggacgattagatgag
cttgagaaagccatcaccactcaaaactgtaatactaaatgtgttaccataccaagcact
tgctctgaaatttggggactgagtacaccaaatacgatagatcagtgggatacaacaggc
ctttacagcttctctgaacaaaccaggtctcttgatggtcgtctccaggtatcccatcga
aaaggattgccacatgttatatattgccgattatggcgctggcctgatcttcacagtcat
catgaactcaaggcaattgaaaactgcgaatatgcttttaatcttaaaaaggatgaagta
tgtgtaaacccttaccactatcagagagttgagacaccagttttgcctccagtattagtg
ccccgacacaccgagatcctaacagaacttccgcctctggatgactatactcactccatt
ccagaaaacactaacttcccagcaggaattgagccacagagtaattatattccagaaacg
ccacctcctggatatatcagtgaagatggagaaacaagtgaccaacagttgaatcaaagt
atggacacaggatctccagcagaactatctcctactactctttcccctgttaatcatagc
ttggatttacagccagttacttactcagaacctgcattttggtgttcaatagcatattat
gaattaaatcagagggttggagaaaccttccatgcatcacagccctcactcactgtagat
ggctttacagacccatcaaattcagagaggttctgcttaggtttactctccaatgttaac
cgaaatgccacagtagaaatgacaagaaggcatataggaagaggagtgcgcttatactac
ataggtggggaagtttttgctgagtgcctaagtgatagtgcaatctttgtgcagagcccc
aattgtaatcagagatatggctggcaccctgcaacagtgtgtaaaattcccccaggctgt
aatctgaagatcttcaacaaccaggaatttgctgctcttctggctcagtctgttaatcag
ggttttgaagccgtctatcagctaactagaatgtgcaccataagaatgagttttgtgaaa
gggtggggagcagaataccgaaggcagacggtaacaagtactccttgctggattgaactt
catctgaatggacctctacagtggttggacaaagtattaactcagatgggatccccttca
gtgcgttgctcaagcatgtcataa

KEGG   Pan paniscus (bonobo): 100993322
Entry
100993322         CDS       T02283                                 

Gene name
SMAD3
Definition
(RefSeq) SMAD family member 3
  KO
K23605  mothers against decapentaplegic homolog 3
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04068  FoxO signaling pathway
pps04110  Cell cycle
pps04144  Endocytosis
pps04218  Cellular senescence
pps04310  Wnt signaling pathway
pps04350  TGF-beta signaling pathway
pps04371  Apelin signaling pathway
pps04390  Hippo signaling pathway
pps04520  Adherens junction
pps04550  Signaling pathways regulating pluripotency of stem cells
pps04659  Th17 cell differentiation
pps04933  AGE-RAGE signaling pathway in diabetic complications
pps05161  Hepatitis B
pps05166  Human T-cell leukemia virus 1 infection
pps05200  Pathways in cancer
pps05210  Colorectal cancer
pps05212  Pancreatic cancer
pps05220  Chronic myeloid leukemia
pps05225  Hepatocellular carcinoma
pps05226  Gastric cancer
pps05321  Inflammatory bowel disease
pps05415  Diabetic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100993322 (SMAD3)
   04350 TGF-beta signaling pathway
    100993322 (SMAD3)
   04390 Hippo signaling pathway
    100993322 (SMAD3)
   04371 Apelin signaling pathway
    100993322 (SMAD3)
   04068 FoxO signaling pathway
    100993322 (SMAD3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100993322 (SMAD3)
  09143 Cell growth and death
   04110 Cell cycle
    100993322 (SMAD3)
   04218 Cellular senescence
    100993322 (SMAD3)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    100993322 (SMAD3)
   04550 Signaling pathways regulating pluripotency of stem cells
    100993322 (SMAD3)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    100993322 (SMAD3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100993322 (SMAD3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100993322 (SMAD3)
   05212 Pancreatic cancer
    100993322 (SMAD3)
   05225 Hepatocellular carcinoma
    100993322 (SMAD3)
   05226 Gastric cancer
    100993322 (SMAD3)
   05220 Chronic myeloid leukemia
    100993322 (SMAD3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100993322 (SMAD3)
   05161 Hepatitis B
    100993322 (SMAD3)
  09163 Immune disease
   05321 Inflammatory bowel disease
    100993322 (SMAD3)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    100993322 (SMAD3)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100993322 (SMAD3)
SSDB
Motif
Pfam: MH2 MH1 IRF-3
Other DBs
NCBI-GeneID: 100993322
NCBI-ProteinID: XP_003828052
UniProt: A0A2R9AV36
Position
15
AA seq 425 aa
MSSILPFTPPIVKRLLGWKKGEQNGQEEKWCEKAVKSLVKKLKKTGQLDELEKAITTQNV
NTKCITIPRSLDGRLQVSHRKGLPHVIYCRLWRWPDLHSHHELRAMELCEFAFNMKKDEV
CVNPYHYQRVETPVLPPVLVPRHTEIPAEFPPLDDYSHSIPENTNFPAGIEPQSNIPETP
PPGYLSEDGETSDHQMNHSMDAGSPNLSPNPMSPAHNNLDLQPVTYCEPAFWCSISYYEL
NQRVGETFHASQPSMTVDGFTDPSNSERFCLGLLSNVNRNAAVELTRRHIGRGVRLYYIG
GEVFAECLSDSAIFVQSPNCNQRYGWHPATVCKIPPGCNLKIFNNQEFAALLAQSVNQGF
EAVYQLTRMCTIRMSFVKGWGAEYRRQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSIR
CSSVS
NT seq 1278 nt   +upstreamnt  +downstreamnt
atgtcgtccatcctgcctttcactcccccgatcgtgaagcgcctgctgggctggaagaag
ggcgagcagaacgggcaggaggagaaatggtgcgagaaggcggtcaagagcctggtcaag
aaactcaaaaagacggggcagctggacgagctggagaaggccatcaccacgcagaacgtc
aacaccaagtgcatcaccatccccaggtccctggatggccggttgcaggtgtcccatcgg
aaggggctccctcatgtcatctactgccgcctgtggcgatggccagacctgcacagccac
cacgagctgcgggccatggagctgtgtgagttcgccttcaatatgaagaaggacgaggtc
tgcgtgaatccctaccactaccagagagtagagacaccagttctacctcctgtgttggtg
ccacgccacacagagatcccggccgagttccccccactggacgactacagccattccatc
cccgaaaacactaacttccccgcaggcatcgagccccagagcaatattccagagacccca
ccccctggctacctgagtgaagatggagaaaccagtgaccaccagatgaaccacagcatg
gacgcaggttctccaaacctatccccgaatccgatgtccccagcacataataacttggac
ctgcagccagttacctactgcgagccggccttctggtgctccatctcctactacgagctg
aaccagcgcgtcggggagacattccacgcctcgcagccatccatgactgtggatggcttc
accgacccctccaattcggagcgcttctgcctagggctgctctccaatgtcaacaggaat
gcagcagtggagctgacacggagacacatcggaagaggcgtgcggctctactacatcgga
ggggaggtcttcgcagagtgcctcagtgacagcgctatttttgtccagtctcccaactgt
aaccagcgctatggctggcacccggccaccgtctgcaagatcccaccaggatgcaacctg
aagatcttcaacaaccaggagttcgctgccctcctggcccagtccgtcaaccagggcttt
gaggctgtctaccagttgacccgaatgtgcaccatccgcatgagcttcgtcaaaggctgg
ggagcggagtacaggagacagactgtgaccagtaccccctgctggatcgagctgcacctg
aatgggcctttgcagtggcttgacaaggtcctcacccagatgggctccccaagcatccgc
tgttccagtgtgtcttag

DBGET integrated database retrieval system