KEGG   Pan paniscus (bonobo): 100980711
Entry
100980711         CDS       T02283                                 

Definition
(RefSeq) angiotensin-converting enzyme
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04614  Renin-angiotensin system
pps04924  Renin secretion
pps05142  Chagas disease
pps05171  Coronavirus disease - COVID-19
pps05410  Hypertrophic cardiomyopathy
pps05415  Diabetic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:pps00001]
 09150 Organismal Systems
  09152 Endocrine system
   04924 Renin secretion
    100980711
   04614 Renin-angiotensin system
    100980711
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    100980711
  09174 Infectious disease: parasitic
   05142 Chagas disease
    100980711
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    100980711
   05415 Diabetic cardiomyopathy
    100980711
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:pps01002]
    100980711
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pps04147]
    100980711
   04090 CD molecules [BR:pps04090]
    100980711
Enzymes [BR:pps01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     100980711
Peptidases and inhibitors [BR:pps01002]
 Metallo peptidases
  Family M2
   100980711
Exosome [BR:pps04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100980711
CD molecules [BR:pps04090]
 Proteins
  100980711
SSDB
Motif
Pfam: Peptidase_M2
Other DBs
NCBI-GeneID: 100980711
NCBI-ProteinID: XP_008961999
UniProt: A0A2R8ZYP1
Position
17
AA seq 732 aa
MGQGWATAGLPSLLFLLLCYGHPLLVPSQEAPRQVTVTHGTSSQATTSGQTTTHQATAHQ
TSAQSPNLVTDEAEASKFVEEYDRTSQVVWNEYAEANWNYNTNITTETSKILLQKNMQIA
NHTLKYGTQARRFDVNQLQNTTIKRIIKKVQDLERAALPAQELEEYNKILLDMETTYSVA
TVCHTNGSCLQLEPDLTNVMATSRKYEDLLWAWEGWRDKAGRAILQFYPKYVELINQAAR
LNGYVDAGDSWRSMYETPSLEQDLERLFQELQPLYLNLHAYVRRALHRHYGAQHINLEGP
IPAHLLGNMWAQTWSNIYDLVVPFPSAPSMDTTEAMLKQGWTPRRMFKEADDFFTSLGLL
PVPPEFWNKSMLEKPTDGREVVCHASAWDFYNGKDFRIKQCTTVNLEDLVVAHHEMGHIQ
YFMQYKDLPVALREGANPGFHEAIGDVLALSVSTPKHLHSLNLLSSEGGSDEHDINFLMK
MALDKIAFIPFSYLVDQWRWRVFDGSITKENYNQEWWSLRLKYQGLCPPVPRTQGDFDPG
AKFHIPSSVPYIRYFVSFIIQFQFHEALCQAAGHTGPLHKCDIYQSKEAGQRLATAMKLG
FSRPWPEAMQLITGQPNMSASAMLSYFKPLLDWLRTENELHGEKLGWPQYNWTPNSARSE
GPLPDSGRVSFLGLDLDAQQARVGQWLLLFLGIALLVATLGLSQRLFSIRHRSLHRHSHG
PQFDSEVELRHS
NT seq 2199 nt   +upstreamnt  +downstreamnt
atgggccagggttgggctactgcaggacttcccagcctcctcttcctgctgctctgctac
gggcaccctctgctggtccctagccaggaggcaccccgacaggtgacagtcacccatggg
acaagcagccaggcaacaaccagcggccagacaaccacccaccaggcgacggcccaccag
acatcagcccagagcccaaacctggtgactgatgaggctgaggccagcaagtttgtggag
gaatatgaccggacatcccaggtggtgtggaacgagtatgccgaggccaactggaactac
aacaccaacatcaccacagagaccagcaagattctgctgcagaagaacatgcagatagcc
aaccacaccctgaaatacggcacccaggccaggaggtttgatgtgaaccagttgcagaac
accactatcaagcggatcataaagaaggttcaggacctagaacgggcagcgctgcctgcc
caggagctggaggagtacaacaagatcctgttggatatggaaaccacctacagcgtggcc
actgtgtgccacacaaatggcagctgcctgcagctcgagccagatctgacgaatgtgatg
gccacatcccggaaatatgaagacttgttatgggcatgggagggctggcgagacaaggcg
gggagagccatcctccagttttacccgaaatacgtggaactcatcaaccaggctgcccgg
ctcaatggctatgtagacgcaggggactcgtggaggtctatgtacgagacaccatccctg
gagcaagacctggagcggctcttccaggagctgcagccgctctacctgaacctgcatgcc
tacgtgcgccgggccctgcaccgtcactatggggcccagcacatcaacctggaggggccc
attcctgctcacctgctggggaacatgtgggcgcagacctggtccaacatctatgacttg
gtggtgcccttcccttcagccccctcgatggacaccacagaggctatgctaaagcagggc
tggacacccaggaggatgtttaaggaggctgatgatttcttcacctccctggggctgctg
cccgtgcctcctgagttctggaacaagtcgatgctggagaagccaaccgacgggcgggag
gtggtctgccacgcctcggcctgggacttctacaacggcaaggacttccggatcaagcag
tgcaccaccgtgaacttggaggacctggtggtggcccaccacgaaatgggccacatccag
tatttcatgcagtacaaagacttacctgtggccttgagggagggtgccaaccccggcttc
catgaggccattggggacgtgctagccctctcagtgtctacgcccaagcacctgcacagt
ctcaacctgctgagcagtgagggtggcagcgacgagcatgacatcaactttctgatgaag
atggcccttgacaagatcgcctttatccccttcagctacctcgtcgatcagtggcgctgg
agggtatttgatggaagcatcaccaaggagaactataaccaggagtggtggagcctcagg
ctgaagtaccagggcctctgccccccagtgcccaggactcaaggtgactttgacccaggg
gccaagttccacattccttctagcgtgccttacatcaggtacttcgtcagcttcatcatc
cagttccagttccatgaggcactgtgccaggcagctggccacacgggccccctgcacaag
tgtgacatctaccagtccaaggaggccgggcagcgcctggcgaccgccatgaagctgggc
ttcagtaggccgtggccggaagccatgcagctgatcacgggccagcccaacatgagcgcc
tcggccatgttgagctacttcaagccgctgctggactggctccgcacggagaacgagctg
catggggagaagctgggctggccgcagtacaactggacgccgaactccgctcgctcagaa
gggcccctcccagacagcggccgcgtcagcttcctgggcctggacctggatgcgcagcag
gcccgcgtgggccagtggctgctgctcttcctgggcatcgccctgctggtagccaccctg
ggcctcagccagcggctcttcagcatccgccaccgcagcctccaccggcactcccacggg
ccccagttcgactccgaggtggagctgagacactcctga

KEGG   Pan paniscus (bonobo): 100981368
Entry
100981368         CDS       T02283                                 

Definition
(RefSeq) angiotensin-converting enzyme-like
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04614  Renin-angiotensin system
pps04924  Renin secretion
pps05142  Chagas disease
pps05171  Coronavirus disease - COVID-19
pps05410  Hypertrophic cardiomyopathy
pps05415  Diabetic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:pps00001]
 09150 Organismal Systems
  09152 Endocrine system
   04924 Renin secretion
    100981368
   04614 Renin-angiotensin system
    100981368
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    100981368
  09174 Infectious disease: parasitic
   05142 Chagas disease
    100981368
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    100981368
   05415 Diabetic cardiomyopathy
    100981368
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:pps01002]
    100981368
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pps04147]
    100981368
   04090 CD molecules [BR:pps04090]
    100981368
Enzymes [BR:pps01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     100981368
Peptidases and inhibitors [BR:pps01002]
 Metallo peptidases
  Family M2
   100981368
Exosome [BR:pps04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100981368
CD molecules [BR:pps04090]
 Proteins
  100981368
SSDB
Motif
Pfam: Peptidase_M2 SmpA_OmlA
Other DBs
NCBI-GeneID: 100981368
NCBI-ProteinID: XP_008962042
Position
17
AA seq 751 aa
MELASPSSAALLVMGARWTCPGPSLLVLLCYGQLFPWLRIKGEHSLDDFYNETEAKIFLQ
FYDQTGEVVLNKFMEATWNYVTNITRKNQEEMLHKDMERSQFMIYFGTQARLFKVTQFKD
PDVNGMLSKLQNIDKAALSKDELREYNELLAYMEMTYSMAQVCLNEGPCLSLEPELEVMA
TSRDKEELLWAWQGWQDAVGCQICTTFEHYVELSNKASQLNGYKDMGALWRSKYESDTLE
QDLERLFQELRPLYLNLHTYVRRALHRHYGPELIDLRGPIPAHLLENTLAQSWVNILDPV
LPFLKKIPEDVTKIMKVQHWKPEKMLEEAETFFTSLALPPAPPSFWKKLMLMRPTDGREV
ECHISAWNFYQDDDFRIKKCTEVTTEDPLSIFHEMGHSXYFLQYKNLSVIFRAGANPAFE
EAVGSVITLSASSHKHLLNIGLLSLXHQDSEDEVNFLMHIALEKIAFIPFGYLMDLFRWK
VFAGTIWKDIYNQEWWNLRLKYQGLCPAIPHSEEDFDPGAKFHISAGVPYIRYFLSLVLR
FQFHETLCKASDHMGPLHQCDIYNSKIAGKLLGDALKLGSSKPWPEVLKMLTGESEVSTK
VFMTYFKPLLTWLVTXNMQQGDILGWPDFSCSFEEKDTDKVTFLSLKLDPNQAKFGYWVL
LALGFVMSLVVLGLACRLQSLEKQSLTQDTEIFSPLPNACFLGIAMEPCQAAKGQWMLLG
LCLVLMLCSISLAIWIFTQXSRKPPRVRAEW
NT seq 2256 nt   +upstreamnt  +downstreamnt
atggagctggcctcacccagctctgctgctctcttggtcatgggagcaaggtggacttgc
cctggaccttccctacttgtgctcctctgttatgggcagctctttccttggctcaggatc
aagggtgaacacagtttagatgacttctacaatgagaccgaggccaagatcttcctgcag
ttttatgaccaaacaggtgaagttgtgttgaacaagttcatggaggccacttggaactat
gtcaccaacatcaccagaaaaaatcaggaggagatgctgcacaaggacatggagaggtcc
cagttcatgatttactttggcacccaggcccgcctgtttaaagtcacccagttcaaggac
ccggatgtgaatggcatgctgagtaagctgcagaacatagacaaggcagctctgtccaag
gacgagctgcgggagtataacgagcttctggcctacatggagatgacatacagtatggcc
caggtgtgcctgaatgaggggccctgcctgtccctggagcctgaactcgaagtcatggcc
acctccagggacaaagaggagctgctgtgggcctggcagggctggcaggatgccgtgggc
tgccagatctgcaccaccttcgagcactatgtggagctcagcaacaaggcttcacagctc
aacggttacaaagacatgggggccttgtggcgctccaagtatgagtcggataccctggag
caagacctggagcggctattccaggagctgcggccactctacctgaacctgcacacctac
gtgcgcagggccctccaccgccactatgggcccgagctcatcgacctgagggggcccatc
cctgcccacctcctggagaacacgttggctcagtcctgggtcaacatcttagacccggtc
ctgcccttcctgaagaagatcccagaggatgtcacaaagatcatgaaagtccagcactgg
aagccagagaaaatgttggaagaggctgagacattcttcacctccttggcgctgccacct
gccccacccagtttctggaaaaagttgatgctaatgaggccaaccgatgggcgagaggtg
gagtgtcacatctctgcctggaacttctaccaggacgacgatttcagaataaagaagtgc
acggaagtgaccacagaagacccgctctccatcttccacgaaatgggccattctnagtac
ttcctgcagtacaagaacctctccgtcatcttccgcgcaggtgccaacccagcctttgaa
gaggctgtggggtctgtgatcaccctctcggcctcctcccacaagcacctgctcaacata
ggcctgctcagcctctagcaccaggactcagaggatgaggtcaatttcctgatgcatatt
gccctggagaagatcgccttcatccccttcggctacctgatggacctgtttcgctggaag
gtctttgccggcaccatctggaaggacatctacaatcaggagtggtggaacctcaggttg
aaataccagggcttgtgccccgctattcctcactcagaggaagactttgatccaggtgcc
aagttccacatttctgctggtgtgccctacatacggtacttcctcagtctggtgctccgg
ttccagttccacgaaacactgtgcaaagcctcggaccacatgggtccactgcaccagtgt
gacatctacaactccaagattgccgggaagctcctgggggatgctctaaagctgggctca
agcaagccctggccagaggtcctaaagatgctgactggggagtctgaggtgtctacaaag
gtcttcatgacctacttcaaacccctactgacctggctggtgacanngaacatgcagcaa
ggggacatcttaggctggccagacttcagctgttcctttgaagaaaaagacacagacaaa
gtgacattcctgagtctgaagctggaccccaaccaggctaaatttgggtactgggtgctg
ttggccctgggctttgtcatgtctctggtggtgctggggctggcctgcaggctgcagtcc
ctggaaaaacagtcactgactcaagacactgagatattcagcccactgcccaatgcctgc
ttcctgggcatagccatggaaccctgccaggctgctaaaggacagtggatgctgctgggc
ctctgccttgtcctgatgctgtgctcaatcagcctggccatctggattttcacacagtaa
agcaggaagcctccaagggtaagagctgaatggtga

KEGG   Pan paniscus (bonobo): 103784926
Entry
103784926         CDS       T02283                                 

Definition
(RefSeq) angiotensin-converting enzyme-like
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04614  Renin-angiotensin system
pps04924  Renin secretion
pps05142  Chagas disease
pps05171  Coronavirus disease - COVID-19
pps05410  Hypertrophic cardiomyopathy
pps05415  Diabetic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:pps00001]
 09150 Organismal Systems
  09152 Endocrine system
   04924 Renin secretion
    103784926
   04614 Renin-angiotensin system
    103784926
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    103784926
  09174 Infectious disease: parasitic
   05142 Chagas disease
    103784926
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    103784926
   05415 Diabetic cardiomyopathy
    103784926
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:pps01002]
    103784926
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pps04147]
    103784926
   04090 CD molecules [BR:pps04090]
    103784926
Enzymes [BR:pps01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     103784926
Peptidases and inhibitors [BR:pps01002]
 Metallo peptidases
  Family M2
   103784926
Exosome [BR:pps04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   103784926
CD molecules [BR:pps04090]
 Proteins
  103784926
SSDB
Motif
Pfam: Peptidase_M2 Peptidase_M32
Other DBs
NCBI-GeneID: 103784926
NCBI-ProteinID: XP_014197673
Position
17
AA seq 547 aa
MSSVLGTATFFLSPPPPLPCNTSSDKSQATSPPLDHGLVKKPARPDQPHPRRTSGACGQL
LGPRPCHSGGGRLRGVGLGRSSRRPLGSQAPAEAARPHAAFSPPDAVAVTVTALHCPSTL
HSPGLFSGPNFCSTIPMRQIPSRRRKRGFCKLRSPEEAALLSQEFAEAWGQKAKELYEPV
WQNFTDPQLRRIIGAVRTLGSANLPLAKRQQYNALLSNMSRIYSTAKVCLPNKTATCWSL
DPDLTNILASSRSYAMLLFAWEGWHNAAGIPLKPLYEDFTALSNEAYKQDGFTDTGAYWR
SWYNSPTFEDDLEHLYQQLEPLYLNLHAFVRRALHRRYGDRYINLRGPIPAHLLGDMWAQ
SWENIYDMVVPFPDKPNLDVTSTMLQQGWNATHMFRVAEEFFTSLELSPMPPEFWEGSML
EKPADGREVVCHASAWDFYNRKDFRIKQCTRVTMDQLSTVHHEMGHIQYYLQYKDLPVSL
RGGANPGFHEAIGDVLALSVSTPAHLHKIGLLDNVTNDTEPSIRASVLLXPETKPTLMLE
LSFMFQM
NT seq 1644 nt   +upstreamnt  +downstreamnt
atgtcctctgtgctagggacagccaccttcttcctctccccaccgccccctctcccctgc
aacacgtcatctgacaagtcacaggcgacgtccccgcccctcgaccatggcctggtgaag
aagccggccaggcccgatcagccccatccccgccgcacgagcggcgcctgcggacagctc
ctggggccccggccttgtcactccggaggcgggaggctccggggggtcgggctgggaaga
tcgagccggaggccgctaggctcccaggccccggccgaggctgcgcggccgcacgctgcc
ttctcacctccggacgctgtcgctgtcaccgtcaccgcactgcactgtccatccaccctc
cactcgcccggcctcttttctggtcccaatttctgctccaccattcccatgaggcagatt
ccctccagaaggaggaagcgcggcttctgcaaactaaggtctcccgaggaagcagccctg
ctcagccaggagtttgcggaggcctggggccagaaggccaaggagctgtatgaaccggtc
tggcagaacttcacggacccgcagctgcgcaggatcatcggagctgtgcgcaccctgggc
tctgccaatctgcccctggctaagcggcagcagtacaacgccctgctaagcaacatgagc
aggatctactccaccgccaaggtctgcctccccaacaagactgccacctgctggtccctg
gacccagatctcacgaacatcctggcttcctcgcgaagctacgccatgctcctgtttgcc
tgggagggctggcacaacgctgcgggcatcccgctgaaaccgctgtacgaggatttcact
gccctcagcaatgaagcctacaagcaggacggcttcacagacacgggggcctactggcgc
tcctggtacaactcccccaccttcgaggacgatctggaacacctctaccaacagctagag
cccctctacctgaacctccatgccttcgtccgccgcgcgctgcatcgccgatacggggac
agatacatcaacctcaggggacccatccctgctcatctgctgggagacatgtgggcccag
agctgggaaaacatctacgacatggtggtgcctttcccagacaagcccaacctcgatgtc
accagtactatgctgcagcagggctggaacgccacgcacatgttccgggtggcagaggag
ttcttcacctccctggagctctccccgatgcctcccgagttctgggaagggtcgatgctg
gagaagccggctgacgggcgggaagtggtgtgccacgcctcggcttgggacttctacaac
aggaaagacttcaggatcaagcagtgcacacgggtcacgatggaccagctctccacagtg
caccatgagatgggccatatacagtactacctgcagtacaaggatctgcccgtctccctg
cgtgggggggccaaccccggcttccatgaggccattggggacgtgctggcgctctcggtc
tccactcctgcacatctgcacaaaatcggcctgctggacaatgtcaccaatgacacggaa
ccaagtatcagggcatctgtcctcctgtgacccgaaacgaaacccactttgatgctggag
ctaagtttcatgttccaaatgtga

DBGET integrated database retrieval system