KEGG   Pan paniscus (bonobo): 100980759
Entry
100980759         CDS       T02283                                 

Gene name
IL17F
Definition
(RefSeq) interleukin 17F
  KO
K05494  interleukin 17F
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04060  Cytokine-cytokine receptor interaction
pps04657  IL-17 signaling pathway
pps04659  Th17 cell differentiation
pps05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100980759 (IL17F)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    100980759 (IL17F)
   04657 IL-17 signaling pathway
    100980759 (IL17F)
 09160 Human Diseases
  09163 Immune disease
   05321 Inflammatory bowel disease
    100980759 (IL17F)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pps04052]
    100980759 (IL17F)
Cytokines and growth factors [BR:pps04052]
 Cytokines
  Interleukins
   100980759 (IL17F)
SSDB
Motif
Pfam: IL17
Other DBs
NCBI-GeneID: 100980759
NCBI-ProteinID: XP_003833209
UniProt: A0A2R9BY33
Position
6
AA seq 163 aa
MTVKTLHGPAMVKYLLLLILGLAFLSEAAARKIPKVGHTFFQKPESCPPVPGDSMKLDIG
IINENQRVSMSRNIESRSTSPWNYTVTRDPNRYPSEVVQAQCRNLGCINAQGKEDISMNS
VPIQQETLVVRRKHQGCSVSFQLEKVLVTVGCTCVTPVIHHVQ
NT seq 492 nt   +upstreamnt  +downstreamnt
atgacagtgaagaccctgcatggcccagccatggtcaagtacttgctgctgttgatattg
gggcttgcctttctgagtgaggcggcagctcggaaaatccccaaagtaggacatactttt
ttccaaaagcctgagagttgcccgcctgtgccaggagatagtatgaaacttgacattggc
atcatcaatgaaaaccagcgtgtttccatgtcacgtaacatcgagagccgctccacctcc
ccctggaattacactgtcactcgggaccccaaccggtacccctcggaagttgtacaggcc
cagtgtaggaacttgggctgcatcaatgctcaaggaaaggaagacatctccatgaattcc
gttcccatccagcaagagaccctggtcgtccggaggaagcaccaaggctgctctgtttct
ttccagttggagaaggtgctggtgactgttggctgcacctgcgtcacccctgtcatccac
catgtgcagtaa

DBGET integrated database retrieval system