KEGG   Pan paniscus (bonobo): 100980801
Entry
100980801         CDS       T02283                                 

Gene name
HR
Definition
(RefSeq) HR, lysine demethylase and nuclear receptor corepressor
  KO
K00478  [histone H3]-dimethyl-L-lysine9 demethylase [EC:1.14.11.65]
Organism
pps  Pan paniscus (bonobo)
Brite
KEGG Orthology (KO) [BR:pps00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pps03036]
    100980801 (HR)
Enzymes [BR:pps01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.65  [histone H3]-dimethyl-L-lysine9 demethylase
     100980801 (HR)
Chromosome and associated proteins [BR:pps03036]
 Eukaryotic type
  Histone modification proteins
   Histone demethylases
    100980801 (HR)
SSDB
Motif
Pfam: JmjC
Other DBs
NCBI-GeneID: 100980801
NCBI-ProteinID: XP_003823656
UniProt: A0A2R9AVM6
Position
8
AA seq 1189 aa
MESTPSFLKGTPTWEKTAPENGIVRQEPGSPPRDGLHHGPLCLGEPAPFWRGVLSTPDSW
LPPGFPQGPKDMLPLVEGEGPQNGERKVNWLGSKEGLRWKEAMLTHPLAFCGPACPPRCG
PLMPEHSGGHLKSDPVAFRPWNCPFLLETKILERAPFWVPTCLPPYLVSGLPPERPCDWA
LTPHPWVYSGGQPKVPSAFSLGSKGFYYKDPSIPRLAKEPLAAAEPGLFGLNPGGHLQRA
GEAERPSLHQRDGEMGAGRQQNPCPLFLGQPDTVPRTSWPACPPGLVHSLGNVWAGPGDG
NLGYQLGPPATPRCPSPEPPVTQRGCCSSYPPTKGGGLGPCGKCQEGLEGGASGASEPSE
EVNKASGPRACPPSHHTKLKKTWLTRHSEQFECPRGCPEVEERPVARLRALKRAGSPEVQ
GAMGSPAPKRPPDPFPGTAEQGAGGWQEVRDTSIGNKEVDSGQHDEQKGPQDGQASLQDP
GLQDIPCLALPAKLAQCQSCAQAAGEGGGHTCHSQQVRRSPLGGEPQQEEDTAANSSSEE
GPGSGPDSRLSTGLAKHLLSGLGDRLCRLLRREREALAWAQREGQGPAVTEDSPGIPRCC
SHCHHGLFNTHWRCPRCSHRLCVACGRVAGTGQAREKAGFQEQSTEECTQEAGHAACSLT
LTQFVSSQALAELSTAMHQVWVKFDIRGHCPCQADARVWAPGDAGQQKESTQKTPPTPQP
SCNGDTHRTKSIKEETPDSAETPAEDRAGRGPLPCPSLCELLASTAVKLCLGHERIHMAF
APVTPALPSDDRITNILDSIIAQVVERKIQEKALGPGLRAGPGLRKGLGLPLSPVRPRLP
PPGALLWLQEPRPWPRRGFHLFQEHWRQGQPVLVSGIQRTLQGNLWGTEALGALGGQVQA
LSPLGPPQPTSLGSTTFWEGFSWPELRPKSDEGSVLLLHRALGDEDTSRVENLAASLPLP
EYCALHGKLNLASYLPPGLALRPLEPQLWAAYGVSPHRGHLGTKNLCVEVADLVSILVHA
DAPLPAWHRAQKDFLSGLDGEGLWSPGSQVSTVWHVFRAQDAQRIRRFLQMVCPAGAGAL
EPGAPGSCYLDAGLRRRLREEWGVSCWTLLQAPGEAVLVPAGAPHQVQGLVSTVSVTQHF
LSPETSALSAQLCHQGPSLPPDCHLLYAQMDWAVFQAVKVAVGTLQEAK
NT seq 3570 nt   +upstreamnt  +downstreamnt
atggagagtacgcccagcttcctgaagggcaccccaacctgggagaagacggccccagag
aacggcatcgtgagacaggagcccggcagcccgcctcgagatggactgcaccatgggccg
ctgtgcctgggagagcctgctcccttttggaggggcgtcctgagcaccccagactcctgg
cttccccctggcttcccccagggccccaaggacatgctcccacttgtggagggcgagggc
ccccagaatggggagaggaaggtcaactggctgggcagcaaagagggactgcgctggaag
gaggccatgcttacccatccgctggcattctgcgggccagcgtgcccacctcgctgtggc
cccctgatgcctgagcatagtggtggccatctcaagagtgaccctgtggccttccggccc
tggaactgccctttccttctggagaccaagatcctggagcgagctcccttctgggtgccc
acctgcttgccaccctacctagtgtctggcctgcccccagagcgtccatgtgactgggcc
ctgaccccgcacccctgggtatactccgggggccagcccaaagtgccctctgccttcagc
ttaggcagcaagggcttttactacaaggatccgagcattcccaggttggcaaaggagccc
ttggcagctgcggaacctgggttgtttggcttaaatcctggtgggcacctgcagagagcc
ggggaggccgaacgcccttcactgcaccagagggatggagagatgggagctggccggcag
cagaatccttgcccactcttcctggggcagccagacactgtgccccggacctcctggccc
gcttgtcccccaggccttgttcatagtcttggcaacgtctgggctgggccaggcgatggg
aaccttgggtaccagctggggccaccagcaacaccaaggtgcccctctcccgagccgcct
gtcacccagcggggctgctgttcatcctacccacccactaaaggtgggggtcttggccct
tgtgggaagtgccaggagggcctggaggggggtgccagtggagccagcgaacccagcgag
gaagtgaacaaggcctctggccccagggcctgcccccccagccaccacaccaagctgaag
aagacatggctcacacggcactcggagcagtttgaatgtccacgcggctgccctgaggtc
gaggagaggccggttgctcggctccgggccctcaaaagggcaggcagccccgaggtccag
ggagcaatgggcagtccagcccccaagcggccaccggaccctttcccaggcactgcagaa
cagggggctgggggttggcaggaggtgcgggacacatcgatagggaacaaggaggtggac
tcgggacagcatgatgagcagaaaggaccccaagatggccaggccagtctccaggacccg
ggacttcaggacataccatgcctggctctccctgcaaaactggctcaatgccaaagttgt
gcccaggcagctggagagggaggagggcacacctgccactctcagcaagtgcggagatca
cctctgggaggggagccgcagcaggaggaagacacagccgccaactccagctctgaggaa
ggcccagggtccggccctgacagccggctcagcacaggcctcgccaagcacctgctcagt
ggtttgggggaccgactgtgccgcctgctgcggagggagcgggaggccctggcttgggcc
cagcgggaaggccaagggccagccgtgacagaggacagcccaggcattccacgctgctgc
agccattgccaccatggactcttcaacacccactggcgatgtccccgctgcagccaccgg
ctgtgtgtggcctgtggtcgtgtggcaggcactgggcaggccagggagaaagcaggcttt
caggagcagtccacggaggagtgcacgcaggaggctgggcacgctgcctgttccctgacg
ctgacccagtttgtctccagccaggctttggcagagctgagcactgcaatgcaccaggtc
tgggtcaagtttgatatccgggggcactgcccctgccaagctgatgcccgggtgtgggcc
cccggggatgcaggccagcagaaggaatcgacacagaaaacgcccccaactccacaacct
tcctgcaatggcgacacccacaggaccaagagcatcaaagaggagacccccgattccgct
gagaccccagcagaggaccgtgctggccgagggcccctgccttgtccttctctctgcgaa
ctgctggcttctaccgcggtcaaactctgcttgggccatgagcgaatacacatggccttc
gcccccgtcactccggccctgcccagtgacgaccgcatcaccaacatcctggacagcatt
atcgcacaggtggtggaacggaagatccaggagaaagccctggggccggggcttcgagct
ggcccgggtctgcgcaagggcctgggcctgcccctctctccagtgcggccccggctgcct
cccccaggggctttgctgtggctgcaggagccccggccttggcctcggcgtggcttccac
ctcttccaggagcactggaggcagggccagcctgtgttggtgtcagggatccaaaggaca
ttgcagggcaacctgtgggggacagaagctctgggggcacttggaggccaggtgcaggca
ctgagccccctcggacctccccagcccaccagcctgggcagcacaacattctgggagggc
ttctcctggcctgagcttcgcccaaagtcagacgagggctctgtcctcctgctgcaccga
gctttgggggatgaggacaccagcagggtggagaacctagctgccagtctgccacttccg
gagtactgcgccctccatggaaaactcaacctggcttcctacctcccaccgggccttgcc
ctgcgtccactggagccccagctctgggcagcctatggtgtgagcccgcaccggggacac
ctggggaccaagaacctctgtgtggaggtggccgacctggtcagcatcctggtgcacgcc
gacgcaccactgcctgcctggcaccgggcacagaaagacttcctttcaggcctggacggg
gaggggctctggtctccgggcagccaggtcagcactgtgtggcacgtgttccgggcacag
gacgcccagcgcatccgccgctttctccagatggtgtgcccggccggggcaggcgccctg
gagcctggcgccccaggcagctgctacctggacgcagggctgcggcggcgcctgcgggag
gagtggggcgtgagctgctggaccctgctccaggcccccggagaggccgtgctggtgcct
gcaggggctccccaccaggtgcagggcctggtgagcacagtcagcgtcactcagcacttc
ctctcccctgagacctctgccctctctgctcagctctgccaccagggacccagccttccc
cctgactgccacctgctttatgcccagatggactgggctgtgttccaagcagtgaaggtg
gccgtggggacattacaggaggccaaatag

DBGET integrated database retrieval system