KEGG   Pan paniscus (bonobo): 100980937
Entry
100980937         CDS       T02283                                 

Gene name
MAPK11
Definition
(RefSeq) mitogen-activated protein kinase 11
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps01522  Endocrine resistance
pps04010  MAPK signaling pathway
pps04015  Rap1 signaling pathway
pps04068  FoxO signaling pathway
pps04071  Sphingolipid signaling pathway
pps04114  Oocyte meiosis
pps04218  Cellular senescence
pps04261  Adrenergic signaling in cardiomyocytes
pps04370  VEGF signaling pathway
pps04380  Osteoclast differentiation
pps04550  Signaling pathways regulating pluripotency of stem cells
pps04611  Platelet activation
pps04613  Neutrophil extracellular trap formation
pps04620  Toll-like receptor signaling pathway
pps04621  NOD-like receptor signaling pathway
pps04622  RIG-I-like receptor signaling pathway
pps04625  C-type lectin receptor signaling pathway
pps04657  IL-17 signaling pathway
pps04658  Th1 and Th2 cell differentiation
pps04659  Th17 cell differentiation
pps04660  T cell receptor signaling pathway
pps04664  Fc epsilon RI signaling pathway
pps04668  TNF signaling pathway
pps04670  Leukocyte transendothelial migration
pps04714  Thermogenesis
pps04722  Neurotrophin signaling pathway
pps04723  Retrograde endocannabinoid signaling
pps04728  Dopaminergic synapse
pps04750  Inflammatory mediator regulation of TRP channels
pps04912  GnRH signaling pathway
pps04914  Progesterone-mediated oocyte maturation
pps04917  Prolactin signaling pathway
pps04926  Relaxin signaling pathway
pps04933  AGE-RAGE signaling pathway in diabetic complications
pps04935  Growth hormone synthesis, secretion and action
pps05014  Amyotrophic lateral sclerosis
pps05020  Prion disease
pps05022  Pathways of neurodegeneration - multiple diseases
pps05132  Salmonella infection
pps05133  Pertussis
pps05135  Yersinia infection
pps05140  Leishmaniasis
pps05142  Chagas disease
pps05145  Toxoplasmosis
pps05152  Tuberculosis
pps05161  Hepatitis B
pps05163  Human cytomegalovirus infection
pps05167  Kaposi sarcoma-associated herpesvirus infection
pps05169  Epstein-Barr virus infection
pps05170  Human immunodeficiency virus 1 infection
pps05171  Coronavirus disease - COVID-19
pps05205  Proteoglycans in cancer
pps05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
pps05415  Diabetic cardiomyopathy
pps05417  Lipid and atherosclerosis
pps05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100980937 (MAPK11)
   04015 Rap1 signaling pathway
    100980937 (MAPK11)
   04370 VEGF signaling pathway
    100980937 (MAPK11)
   04668 TNF signaling pathway
    100980937 (MAPK11)
   04068 FoxO signaling pathway
    100980937 (MAPK11)
   04071 Sphingolipid signaling pathway
    100980937 (MAPK11)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100980937 (MAPK11)
   04218 Cellular senescence
    100980937 (MAPK11)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100980937 (MAPK11)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100980937 (MAPK11)
   04613 Neutrophil extracellular trap formation
    100980937 (MAPK11)
   04620 Toll-like receptor signaling pathway
    100980937 (MAPK11)
   04621 NOD-like receptor signaling pathway
    100980937 (MAPK11)
   04622 RIG-I-like receptor signaling pathway
    100980937 (MAPK11)
   04625 C-type lectin receptor signaling pathway
    100980937 (MAPK11)
   04660 T cell receptor signaling pathway
    100980937 (MAPK11)
   04658 Th1 and Th2 cell differentiation
    100980937 (MAPK11)
   04659 Th17 cell differentiation
    100980937 (MAPK11)
   04657 IL-17 signaling pathway
    100980937 (MAPK11)
   04664 Fc epsilon RI signaling pathway
    100980937 (MAPK11)
   04670 Leukocyte transendothelial migration
    100980937 (MAPK11)
  09152 Endocrine system
   04912 GnRH signaling pathway
    100980937 (MAPK11)
   04914 Progesterone-mediated oocyte maturation
    100980937 (MAPK11)
   04917 Prolactin signaling pathway
    100980937 (MAPK11)
   04926 Relaxin signaling pathway
    100980937 (MAPK11)
   04935 Growth hormone synthesis, secretion and action
    100980937 (MAPK11)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100980937 (MAPK11)
  09156 Nervous system
   04728 Dopaminergic synapse
    100980937 (MAPK11)
   04723 Retrograde endocannabinoid signaling
    100980937 (MAPK11)
   04722 Neurotrophin signaling pathway
    100980937 (MAPK11)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100980937 (MAPK11)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100980937 (MAPK11)
  09159 Environmental adaptation
   04714 Thermogenesis
    100980937 (MAPK11)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    100980937 (MAPK11)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100980937 (MAPK11)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100980937 (MAPK11)
   05161 Hepatitis B
    100980937 (MAPK11)
   05171 Coronavirus disease - COVID-19
    100980937 (MAPK11)
   05163 Human cytomegalovirus infection
    100980937 (MAPK11)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100980937 (MAPK11)
   05169 Epstein-Barr virus infection
    100980937 (MAPK11)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100980937 (MAPK11)
   05135 Yersinia infection
    100980937 (MAPK11)
   05133 Pertussis
    100980937 (MAPK11)
   05152 Tuberculosis
    100980937 (MAPK11)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100980937 (MAPK11)
   05140 Leishmaniasis
    100980937 (MAPK11)
   05142 Chagas disease
    100980937 (MAPK11)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    100980937 (MAPK11)
   05020 Prion disease
    100980937 (MAPK11)
   05022 Pathways of neurodegeneration - multiple diseases
    100980937 (MAPK11)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100980937 (MAPK11)
   05418 Fluid shear stress and atherosclerosis
    100980937 (MAPK11)
   05415 Diabetic cardiomyopathy
    100980937 (MAPK11)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100980937 (MAPK11)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100980937 (MAPK11)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pps01001]
    100980937 (MAPK11)
Enzymes [BR:pps01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     100980937 (MAPK11)
Protein kinases [BR:pps01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   100980937 (MAPK11)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo ABC1 APH RIO1 Cas_CT1975 Kinase-like
Other DBs
NCBI-GeneID: 100980937
NCBI-ProteinID: XP_008961655
Position
22
AA seq 370 aa
MVVQPQGLLPSKRGGEAARGTPPGSTRVRPPSDPSRRRLTRPSSSSAYDARLRQKVAVKK
LSRPFQSLIHARRTYRELRLLKHLKHENVIGLLDVFTPATSIEDFSEVYLVTTLMGADLN
NIVKCQALSDEHVQFLVYQLLRGLKYIHSAGIIHRDLKPSNVAVNEDCELRILDFGLARQ
ADEEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLQGKALFPGSDYIDQLKR
IMEVVGTPSPEVLAKISSEHARTYIQSLPPMPQKDLSSIFRGANPLAIDLLGRMLVLDSD
QRVSAAEALAHAYFSQYHDPEDEPEAEPYDESVEAKERTLEEWKELTYQEVLSFKPPEPP
KPPGSLEIEQ
NT seq 1113 nt   +upstreamnt  +downstreamnt
atggtggtccagccccagggactccttcccagcaagcgcggaggggaagcggcgagaggg
acgccgcccgggtccacgcgcgtgcggccgccctcggacccctcccggcgccgcctcact
cgcccgtcttccagttcggcctacgacgcccggctgcgccagaaggtggcggtgaagaag
ctgtcgcgccccttccagtcgctgatccacgcgcgcagaacgtaccgggagctgcggctg
ctcaagcacctgaagcacgagaacgtcatcgggcttctggacgtcttcacgccggccacg
tccatcgaggacttcagcgaagtgtacttggtgaccaccctgatgggcgccgacctgaac
aacatcgtcaagtgccaggcgctgagcgacgagcacgttcaattcctggtttaccagctg
ctgcgcgggctgaagtacatccactcggccgggatcatccaccgggacctgaagcccagc
aacgtggctgtgaacgaggactgtgagctcaggatcctggatttcgggctggcacgccag
gcggacgaggagatgaccggctatgtggccacacgctggtaccgggcacctgagatcatg
ctcaactggatgcattacaaccaaacagtggatatctggtccgtgggctgcatcatggct
gagctgctccagggcaaggccctcttcccgggaagcgactacattgaccagctgaagcgc
atcatggaagtggtgggcacacccagccctgaggttctggcaaaaatctcctcggaacac
gcccggacatatatccagtccctgccccccatgccccagaaggacctgagcagcatcttc
cgtggagccaaccccctggccatagacctccttggaaggatgctggtgctggacagtgac
cagagggtcagtgcggctgaggcactggcccacgcctacttcagccagtaccacgacccc
gaggatgagccagaggccgagccatatgatgagagcgttgaggccaaggagcgcacgctg
gaggagtggaaggagctcacttaccaggaagtcctcagcttcaagcccccagagccaccg
aagccacctggcagcctggagattgagcagtga

KEGG   Pan paniscus (bonobo): 100981268
Entry
100981268         CDS       T02283                                 

Gene name
MAPK12
Definition
(RefSeq) mitogen-activated protein kinase 12
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps01522  Endocrine resistance
pps04010  MAPK signaling pathway
pps04015  Rap1 signaling pathway
pps04068  FoxO signaling pathway
pps04071  Sphingolipid signaling pathway
pps04114  Oocyte meiosis
pps04218  Cellular senescence
pps04261  Adrenergic signaling in cardiomyocytes
pps04370  VEGF signaling pathway
pps04380  Osteoclast differentiation
pps04550  Signaling pathways regulating pluripotency of stem cells
pps04611  Platelet activation
pps04613  Neutrophil extracellular trap formation
pps04620  Toll-like receptor signaling pathway
pps04621  NOD-like receptor signaling pathway
pps04622  RIG-I-like receptor signaling pathway
pps04625  C-type lectin receptor signaling pathway
pps04657  IL-17 signaling pathway
pps04658  Th1 and Th2 cell differentiation
pps04659  Th17 cell differentiation
pps04660  T cell receptor signaling pathway
pps04664  Fc epsilon RI signaling pathway
pps04668  TNF signaling pathway
pps04670  Leukocyte transendothelial migration
pps04714  Thermogenesis
pps04722  Neurotrophin signaling pathway
pps04723  Retrograde endocannabinoid signaling
pps04728  Dopaminergic synapse
pps04750  Inflammatory mediator regulation of TRP channels
pps04912  GnRH signaling pathway
pps04914  Progesterone-mediated oocyte maturation
pps04917  Prolactin signaling pathway
pps04926  Relaxin signaling pathway
pps04933  AGE-RAGE signaling pathway in diabetic complications
pps04935  Growth hormone synthesis, secretion and action
pps05014  Amyotrophic lateral sclerosis
pps05020  Prion disease
pps05022  Pathways of neurodegeneration - multiple diseases
pps05132  Salmonella infection
pps05133  Pertussis
pps05135  Yersinia infection
pps05140  Leishmaniasis
pps05142  Chagas disease
pps05145  Toxoplasmosis
pps05152  Tuberculosis
pps05161  Hepatitis B
pps05163  Human cytomegalovirus infection
pps05167  Kaposi sarcoma-associated herpesvirus infection
pps05169  Epstein-Barr virus infection
pps05170  Human immunodeficiency virus 1 infection
pps05171  Coronavirus disease - COVID-19
pps05205  Proteoglycans in cancer
pps05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
pps05415  Diabetic cardiomyopathy
pps05417  Lipid and atherosclerosis
pps05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100981268 (MAPK12)
   04015 Rap1 signaling pathway
    100981268 (MAPK12)
   04370 VEGF signaling pathway
    100981268 (MAPK12)
   04668 TNF signaling pathway
    100981268 (MAPK12)
   04068 FoxO signaling pathway
    100981268 (MAPK12)
   04071 Sphingolipid signaling pathway
    100981268 (MAPK12)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100981268 (MAPK12)
   04218 Cellular senescence
    100981268 (MAPK12)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100981268 (MAPK12)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100981268 (MAPK12)
   04613 Neutrophil extracellular trap formation
    100981268 (MAPK12)
   04620 Toll-like receptor signaling pathway
    100981268 (MAPK12)
   04621 NOD-like receptor signaling pathway
    100981268 (MAPK12)
   04622 RIG-I-like receptor signaling pathway
    100981268 (MAPK12)
   04625 C-type lectin receptor signaling pathway
    100981268 (MAPK12)
   04660 T cell receptor signaling pathway
    100981268 (MAPK12)
   04658 Th1 and Th2 cell differentiation
    100981268 (MAPK12)
   04659 Th17 cell differentiation
    100981268 (MAPK12)
   04657 IL-17 signaling pathway
    100981268 (MAPK12)
   04664 Fc epsilon RI signaling pathway
    100981268 (MAPK12)
   04670 Leukocyte transendothelial migration
    100981268 (MAPK12)
  09152 Endocrine system
   04912 GnRH signaling pathway
    100981268 (MAPK12)
   04914 Progesterone-mediated oocyte maturation
    100981268 (MAPK12)
   04917 Prolactin signaling pathway
    100981268 (MAPK12)
   04926 Relaxin signaling pathway
    100981268 (MAPK12)
   04935 Growth hormone synthesis, secretion and action
    100981268 (MAPK12)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100981268 (MAPK12)
  09156 Nervous system
   04728 Dopaminergic synapse
    100981268 (MAPK12)
   04723 Retrograde endocannabinoid signaling
    100981268 (MAPK12)
   04722 Neurotrophin signaling pathway
    100981268 (MAPK12)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100981268 (MAPK12)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100981268 (MAPK12)
  09159 Environmental adaptation
   04714 Thermogenesis
    100981268 (MAPK12)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    100981268 (MAPK12)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100981268 (MAPK12)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100981268 (MAPK12)
   05161 Hepatitis B
    100981268 (MAPK12)
   05171 Coronavirus disease - COVID-19
    100981268 (MAPK12)
   05163 Human cytomegalovirus infection
    100981268 (MAPK12)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100981268 (MAPK12)
   05169 Epstein-Barr virus infection
    100981268 (MAPK12)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100981268 (MAPK12)
   05135 Yersinia infection
    100981268 (MAPK12)
   05133 Pertussis
    100981268 (MAPK12)
   05152 Tuberculosis
    100981268 (MAPK12)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100981268 (MAPK12)
   05140 Leishmaniasis
    100981268 (MAPK12)
   05142 Chagas disease
    100981268 (MAPK12)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    100981268 (MAPK12)
   05020 Prion disease
    100981268 (MAPK12)
   05022 Pathways of neurodegeneration - multiple diseases
    100981268 (MAPK12)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100981268 (MAPK12)
   05418 Fluid shear stress and atherosclerosis
    100981268 (MAPK12)
   05415 Diabetic cardiomyopathy
    100981268 (MAPK12)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100981268 (MAPK12)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100981268 (MAPK12)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pps01001]
    100981268 (MAPK12)
Enzymes [BR:pps01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     100981268 (MAPK12)
Protein kinases [BR:pps01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   100981268 (MAPK12)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 APH Kinase-like Haspin_kinase
Other DBs
NCBI-GeneID: 100981268
NCBI-ProteinID: XP_014198848
Position
22
AA seq 283 aa
MRHENVIGLLDVFTPDETLDDFTDFYLVMPFMGTDLGKLMKHEKLGEDRIQFLVYQMLKG
LRYIHAAGIIHRDLKPGNLAVNEDCELKILDFGLARQADSEMTGYVVTRWYRAPEVILNW
MRYTQTVDIWSVGCIMAEMITGKTLFKGSDHLDQLKEIMKVTGTPPAEFVQRLQSDEAKN
YMKGLPELEKKDFASILTNASPLAVNLLEKMLVLDAEQRVTAAEALAHPYFESLHDTEDE
PQVQKYDDSFDDVDRTLDEWKREWGAPGTACVDPSGGLWAGPV
NT seq 852 nt   +upstreamnt  +downstreamnt
atgcgccacgagaacgtgatcgggctgctggacgtattcactcctgatgagaccctggat
gacttcacggacttttacctggtgatgccgttcatgggcaccgacctgggcaagctcatg
aaacatgagaagctaggcgaggaccggatccagttcctcgtgtaccagatgctgaagggg
ctgaggtatatccacgctgctggcatcatccacagagacctgaagcccggcaacctggct
gtgaacgaagactgtgagctgaagatcctggacttcggcctggccaggcaggcagacagt
gagatgactgggtacgtggtgacccggtggtaccgggctcccgaggtcatcttgaattgg
atgcgctacacgcagacggtggacatctggtctgtgggctgcatcatggcggagatgatc
acaggcaagacgctgttcaagggcagcgaccacctggaccagctgaaggagatcatgaag
gtgacggggacgcctccggctgagtttgtgcagcggctgcagagcgatgaggccaagaac
tacatgaagggcctccccgaattggagaagaaggattttgcctctatcctgaccaatgca
agccctctggctgtgaacctcctggagaagatgctggtgctggacgcggagcagcgggtg
acagcagccgaggcgctggcccatccctacttcgagtccctgcacgacacggaagatgag
ccccaggtccagaagtatgatgactcctttgacgacgtggaccgcacactggatgaatgg
aagcgtgagtggggggctcctggcacggcctgtgtggacccaagtggggggctctgggca
gggcctgtgtga

KEGG   Pan paniscus (bonobo): 100982544
Entry
100982544         CDS       T02283                                 

Gene name
MAPK13
Definition
(RefSeq) mitogen-activated protein kinase 13
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps01522  Endocrine resistance
pps04010  MAPK signaling pathway
pps04015  Rap1 signaling pathway
pps04068  FoxO signaling pathway
pps04071  Sphingolipid signaling pathway
pps04114  Oocyte meiosis
pps04218  Cellular senescence
pps04261  Adrenergic signaling in cardiomyocytes
pps04370  VEGF signaling pathway
pps04380  Osteoclast differentiation
pps04550  Signaling pathways regulating pluripotency of stem cells
pps04611  Platelet activation
pps04613  Neutrophil extracellular trap formation
pps04620  Toll-like receptor signaling pathway
pps04621  NOD-like receptor signaling pathway
pps04622  RIG-I-like receptor signaling pathway
pps04625  C-type lectin receptor signaling pathway
pps04657  IL-17 signaling pathway
pps04658  Th1 and Th2 cell differentiation
pps04659  Th17 cell differentiation
pps04660  T cell receptor signaling pathway
pps04664  Fc epsilon RI signaling pathway
pps04668  TNF signaling pathway
pps04670  Leukocyte transendothelial migration
pps04714  Thermogenesis
pps04722  Neurotrophin signaling pathway
pps04723  Retrograde endocannabinoid signaling
pps04728  Dopaminergic synapse
pps04750  Inflammatory mediator regulation of TRP channels
pps04912  GnRH signaling pathway
pps04914  Progesterone-mediated oocyte maturation
pps04917  Prolactin signaling pathway
pps04926  Relaxin signaling pathway
pps04933  AGE-RAGE signaling pathway in diabetic complications
pps04935  Growth hormone synthesis, secretion and action
pps05014  Amyotrophic lateral sclerosis
pps05020  Prion disease
pps05022  Pathways of neurodegeneration - multiple diseases
pps05132  Salmonella infection
pps05133  Pertussis
pps05135  Yersinia infection
pps05140  Leishmaniasis
pps05142  Chagas disease
pps05145  Toxoplasmosis
pps05152  Tuberculosis
pps05161  Hepatitis B
pps05163  Human cytomegalovirus infection
pps05167  Kaposi sarcoma-associated herpesvirus infection
pps05169  Epstein-Barr virus infection
pps05170  Human immunodeficiency virus 1 infection
pps05171  Coronavirus disease - COVID-19
pps05205  Proteoglycans in cancer
pps05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
pps05415  Diabetic cardiomyopathy
pps05417  Lipid and atherosclerosis
pps05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100982544 (MAPK13)
   04015 Rap1 signaling pathway
    100982544 (MAPK13)
   04370 VEGF signaling pathway
    100982544 (MAPK13)
   04668 TNF signaling pathway
    100982544 (MAPK13)
   04068 FoxO signaling pathway
    100982544 (MAPK13)
   04071 Sphingolipid signaling pathway
    100982544 (MAPK13)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100982544 (MAPK13)
   04218 Cellular senescence
    100982544 (MAPK13)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100982544 (MAPK13)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100982544 (MAPK13)
   04613 Neutrophil extracellular trap formation
    100982544 (MAPK13)
   04620 Toll-like receptor signaling pathway
    100982544 (MAPK13)
   04621 NOD-like receptor signaling pathway
    100982544 (MAPK13)
   04622 RIG-I-like receptor signaling pathway
    100982544 (MAPK13)
   04625 C-type lectin receptor signaling pathway
    100982544 (MAPK13)
   04660 T cell receptor signaling pathway
    100982544 (MAPK13)
   04658 Th1 and Th2 cell differentiation
    100982544 (MAPK13)
   04659 Th17 cell differentiation
    100982544 (MAPK13)
   04657 IL-17 signaling pathway
    100982544 (MAPK13)
   04664 Fc epsilon RI signaling pathway
    100982544 (MAPK13)
   04670 Leukocyte transendothelial migration
    100982544 (MAPK13)
  09152 Endocrine system
   04912 GnRH signaling pathway
    100982544 (MAPK13)
   04914 Progesterone-mediated oocyte maturation
    100982544 (MAPK13)
   04917 Prolactin signaling pathway
    100982544 (MAPK13)
   04926 Relaxin signaling pathway
    100982544 (MAPK13)
   04935 Growth hormone synthesis, secretion and action
    100982544 (MAPK13)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100982544 (MAPK13)
  09156 Nervous system
   04728 Dopaminergic synapse
    100982544 (MAPK13)
   04723 Retrograde endocannabinoid signaling
    100982544 (MAPK13)
   04722 Neurotrophin signaling pathway
    100982544 (MAPK13)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100982544 (MAPK13)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100982544 (MAPK13)
  09159 Environmental adaptation
   04714 Thermogenesis
    100982544 (MAPK13)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    100982544 (MAPK13)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100982544 (MAPK13)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100982544 (MAPK13)
   05161 Hepatitis B
    100982544 (MAPK13)
   05171 Coronavirus disease - COVID-19
    100982544 (MAPK13)
   05163 Human cytomegalovirus infection
    100982544 (MAPK13)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100982544 (MAPK13)
   05169 Epstein-Barr virus infection
    100982544 (MAPK13)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100982544 (MAPK13)
   05135 Yersinia infection
    100982544 (MAPK13)
   05133 Pertussis
    100982544 (MAPK13)
   05152 Tuberculosis
    100982544 (MAPK13)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100982544 (MAPK13)
   05140 Leishmaniasis
    100982544 (MAPK13)
   05142 Chagas disease
    100982544 (MAPK13)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    100982544 (MAPK13)
   05020 Prion disease
    100982544 (MAPK13)
   05022 Pathways of neurodegeneration - multiple diseases
    100982544 (MAPK13)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100982544 (MAPK13)
   05418 Fluid shear stress and atherosclerosis
    100982544 (MAPK13)
   05415 Diabetic cardiomyopathy
    100982544 (MAPK13)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100982544 (MAPK13)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100982544 (MAPK13)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pps01001]
    100982544 (MAPK13)
Enzymes [BR:pps01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     100982544 (MAPK13)
Protein kinases [BR:pps01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   100982544 (MAPK13)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 APH Kinase-like Kdo DUF5898 FTA2 DUF4023 DUF3231
Other DBs
NCBI-GeneID: 100982544
NCBI-ProteinID: XP_003818960
Position
6
AA seq 365 aa
MSLIRKKGFYKQDVNKTAWELPKTYVSPTHVGSGAYGSVCSAIDKRSGEKVAIKKLSRPF
QSEIFAKRAYRELLLLKHMQHENVIGLLDVFTPASSLRNFHDFYLVMPFMQTDLQKIMGM
EFSEEKIQYLVYQMLKGLKYIHSAGVVHRDLKPGNLAVNEDCELKILDFGLARHADAEMT
GYVVTRWYRAPEVILSWMHYNQTVDIWSVGCIMAEMLTGKTLFKGKDYLDQLTQILKVTG
VPGTEFVQKLNDKAAKSYIQSLPQTPRKDFTQLFPRASPQAADLLEKMLELDVDKRLTAA
QALTHPFFEPFRDPEEETEAQQPFDDSLEHEKLTVDEWKQHIYKEIVNFSPIARKDSRRR
SGMKL
NT seq 1098 nt   +upstreamnt  +downstreamnt
atgagcctcatccggaaaaagggcttctacaagcaggacgtcaacaagaccgcctgggag
ctgcccaagacctacgtgtccccgacgcacgtcggcagcggggcctatggctccgtgtgc
tcggccatcgacaagcggtcaggggagaaggtggccatcaagaagctgagccgacccttt
cagtctgagatcttcgccaagcgcgcctaccgggagctgctgctgctgaagcacatgcag
catgagaacgtcattgggctcctggatgtcttcaccccagcctcctccctgcgcaacttc
catgacttctacctggtgatgcccttcatgcagacggatctgcagaagatcatggggatg
gagttcagtgaggagaagatccagtacctggtgtatcagatgctcaaaggccttaagtac
atccactcggctggggtcgtgcacagggacctgaagccaggcaacctggctgtgaatgag
gactgtgaactgaagattctggattttgggctggcgcgacatgcagatgccgagatgact
ggctacgtggtgacccgctggtaccgagcccccgaggtgatcctcagctggatgcactac
aaccagacagtggacatctggtctgtgggctgtatcatggcagagatgctgacagggaaa
actctgttcaaggggaaagattacctggaccagctgacccagatcctgaaagtgaccggg
gtgcctggcacggagtttgtgcagaagctgaacgacaaagcggccaaatcctacatccag
tccctgccacagacccccaggaaggatttcactcagctgttcccacgggccagcccccag
gctgcggacctgctggagaagatgctggagctagacgtggacaagcgcctgacggctgcg
caggccctcacccatcccttctttgaacccttccgggaccctgaggaagagacggaggcc
cagcagccgtttgatgattccttagaacacgagaaactcacagtggatgaatggaagcag
cacatctacaaggagattgtgaacttcagccccattgcccggaaggactcacggcgccgg
agtggcatgaagctgtag

KEGG   Pan paniscus (bonobo): 100983649
Entry
100983649         CDS       T02283                                 

Gene name
MAPK14
Definition
(RefSeq) mitogen-activated protein kinase 14
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps01522  Endocrine resistance
pps04010  MAPK signaling pathway
pps04015  Rap1 signaling pathway
pps04068  FoxO signaling pathway
pps04071  Sphingolipid signaling pathway
pps04114  Oocyte meiosis
pps04218  Cellular senescence
pps04261  Adrenergic signaling in cardiomyocytes
pps04370  VEGF signaling pathway
pps04380  Osteoclast differentiation
pps04550  Signaling pathways regulating pluripotency of stem cells
pps04611  Platelet activation
pps04613  Neutrophil extracellular trap formation
pps04620  Toll-like receptor signaling pathway
pps04621  NOD-like receptor signaling pathway
pps04622  RIG-I-like receptor signaling pathway
pps04625  C-type lectin receptor signaling pathway
pps04657  IL-17 signaling pathway
pps04658  Th1 and Th2 cell differentiation
pps04659  Th17 cell differentiation
pps04660  T cell receptor signaling pathway
pps04664  Fc epsilon RI signaling pathway
pps04668  TNF signaling pathway
pps04670  Leukocyte transendothelial migration
pps04714  Thermogenesis
pps04722  Neurotrophin signaling pathway
pps04723  Retrograde endocannabinoid signaling
pps04728  Dopaminergic synapse
pps04750  Inflammatory mediator regulation of TRP channels
pps04912  GnRH signaling pathway
pps04914  Progesterone-mediated oocyte maturation
pps04917  Prolactin signaling pathway
pps04926  Relaxin signaling pathway
pps04933  AGE-RAGE signaling pathway in diabetic complications
pps04935  Growth hormone synthesis, secretion and action
pps05014  Amyotrophic lateral sclerosis
pps05020  Prion disease
pps05022  Pathways of neurodegeneration - multiple diseases
pps05132  Salmonella infection
pps05133  Pertussis
pps05135  Yersinia infection
pps05140  Leishmaniasis
pps05142  Chagas disease
pps05145  Toxoplasmosis
pps05152  Tuberculosis
pps05161  Hepatitis B
pps05163  Human cytomegalovirus infection
pps05167  Kaposi sarcoma-associated herpesvirus infection
pps05169  Epstein-Barr virus infection
pps05170  Human immunodeficiency virus 1 infection
pps05171  Coronavirus disease - COVID-19
pps05205  Proteoglycans in cancer
pps05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
pps05415  Diabetic cardiomyopathy
pps05417  Lipid and atherosclerosis
pps05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100983649 (MAPK14)
   04015 Rap1 signaling pathway
    100983649 (MAPK14)
   04370 VEGF signaling pathway
    100983649 (MAPK14)
   04668 TNF signaling pathway
    100983649 (MAPK14)
   04068 FoxO signaling pathway
    100983649 (MAPK14)
   04071 Sphingolipid signaling pathway
    100983649 (MAPK14)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100983649 (MAPK14)
   04218 Cellular senescence
    100983649 (MAPK14)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100983649 (MAPK14)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100983649 (MAPK14)
   04613 Neutrophil extracellular trap formation
    100983649 (MAPK14)
   04620 Toll-like receptor signaling pathway
    100983649 (MAPK14)
   04621 NOD-like receptor signaling pathway
    100983649 (MAPK14)
   04622 RIG-I-like receptor signaling pathway
    100983649 (MAPK14)
   04625 C-type lectin receptor signaling pathway
    100983649 (MAPK14)
   04660 T cell receptor signaling pathway
    100983649 (MAPK14)
   04658 Th1 and Th2 cell differentiation
    100983649 (MAPK14)
   04659 Th17 cell differentiation
    100983649 (MAPK14)
   04657 IL-17 signaling pathway
    100983649 (MAPK14)
   04664 Fc epsilon RI signaling pathway
    100983649 (MAPK14)
   04670 Leukocyte transendothelial migration
    100983649 (MAPK14)
  09152 Endocrine system
   04912 GnRH signaling pathway
    100983649 (MAPK14)
   04914 Progesterone-mediated oocyte maturation
    100983649 (MAPK14)
   04917 Prolactin signaling pathway
    100983649 (MAPK14)
   04926 Relaxin signaling pathway
    100983649 (MAPK14)
   04935 Growth hormone synthesis, secretion and action
    100983649 (MAPK14)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100983649 (MAPK14)
  09156 Nervous system
   04728 Dopaminergic synapse
    100983649 (MAPK14)
   04723 Retrograde endocannabinoid signaling
    100983649 (MAPK14)
   04722 Neurotrophin signaling pathway
    100983649 (MAPK14)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100983649 (MAPK14)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100983649 (MAPK14)
  09159 Environmental adaptation
   04714 Thermogenesis
    100983649 (MAPK14)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    100983649 (MAPK14)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100983649 (MAPK14)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100983649 (MAPK14)
   05161 Hepatitis B
    100983649 (MAPK14)
   05171 Coronavirus disease - COVID-19
    100983649 (MAPK14)
   05163 Human cytomegalovirus infection
    100983649 (MAPK14)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100983649 (MAPK14)
   05169 Epstein-Barr virus infection
    100983649 (MAPK14)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100983649 (MAPK14)
   05135 Yersinia infection
    100983649 (MAPK14)
   05133 Pertussis
    100983649 (MAPK14)
   05152 Tuberculosis
    100983649 (MAPK14)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100983649 (MAPK14)
   05140 Leishmaniasis
    100983649 (MAPK14)
   05142 Chagas disease
    100983649 (MAPK14)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    100983649 (MAPK14)
   05020 Prion disease
    100983649 (MAPK14)
   05022 Pathways of neurodegeneration - multiple diseases
    100983649 (MAPK14)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100983649 (MAPK14)
   05418 Fluid shear stress and atherosclerosis
    100983649 (MAPK14)
   05415 Diabetic cardiomyopathy
    100983649 (MAPK14)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100983649 (MAPK14)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100983649 (MAPK14)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pps01001]
    100983649 (MAPK14)
Enzymes [BR:pps01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     100983649 (MAPK14)
Protein kinases [BR:pps01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   100983649 (MAPK14)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 Kdo APH NAD_binding_8 Kinase-like
Other DBs
NCBI-GeneID: 100983649
NCBI-ProteinID: XP_003818964
UniProt: A0A2R9C8T7
Position
6
AA seq 360 aa
MSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQ
SIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQ
KLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMT
GYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVG
TPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAA
QALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES
NT seq 1083 nt   +upstreamnt  +downstreamnt
atgtctcaggagaggcccacgttctaccggcaggagctgaacaagacaatctgggaggtg
cccgagcgttaccagaacctgtctccagtgggctctggcgcctatggctctgtgtgtgct
gcttttgacacaaaaacggggttacgtgtggcagtgaagaagctctccagaccatttcag
tccatcattcatgcaaaaagaacctacagagaactgcggttacttaaacatatgaaacat
gaaaatgtgattggtctgttggacgtttttacacctgcaaggtctctggaggaattcaat
gatgtgtatctggtgacccatctcatgggggcagatctgaacaacattgtgaaatgtcag
aagcttacagatgaccatgttcagttccttatctaccaaattctccgaggtctaaagtat
atacattcagctgacataattcacagggacctaaaacctagtaatctagctgtgaatgaa
gactgtgagctgaagattctggattttggactggctcggcacacagatgatgaaatgaca
ggctacgtggccactaggtggtacagggctcctgagatcatgctgaactggatgcattac
aaccagacagttgatatttggtcagtgggatgcataatggccgagctgttgactggaaga
acattgtttcctggtacagaccatattgatcagttgaagctcattttaagactcgttgga
accccaggggctgagcttttgaagaaaatctcctcagagtctgcaagaaactatattcag
tctttgactcagatgccaaagatgaactttgcgaatgtatttattggtgccaatccgctg
gctgtcgacttgctggagaagatgcttgtattggactcagataagagaattacagcggcc
caagcccttgcacatgcctactttgctcagtaccacgatcctgatgatgaaccagtggcc
gatccttatgatcagtcctttgaaagcagggacctccttatagatgagtggaaaagcctg
acctatgatgaagtcatcagctttgtgccaccaccccttgaccaagaagagatggagtcc
tga

DBGET integrated database retrieval system