KEGG   Pan paniscus (bonobo): 100980947
Entry
100980947         CDS       T02283                                 

Gene name
TGFB1
Definition
(RefSeq) transforming growth factor beta 1
  KO
K13375  transforming growth factor beta-1
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04010  MAPK signaling pathway
pps04060  Cytokine-cytokine receptor interaction
pps04068  FoxO signaling pathway
pps04110  Cell cycle
pps04218  Cellular senescence
pps04350  TGF-beta signaling pathway
pps04380  Osteoclast differentiation
pps04390  Hippo signaling pathway
pps04659  Th17 cell differentiation
pps04672  Intestinal immune network for IgA production
pps04926  Relaxin signaling pathway
pps04932  Non-alcoholic fatty liver disease
pps04933  AGE-RAGE signaling pathway in diabetic complications
pps05140  Leishmaniasis
pps05142  Chagas disease
pps05144  Malaria
pps05145  Toxoplasmosis
pps05146  Amoebiasis
pps05152  Tuberculosis
pps05161  Hepatitis B
pps05166  Human T-cell leukemia virus 1 infection
pps05200  Pathways in cancer
pps05205  Proteoglycans in cancer
pps05210  Colorectal cancer
pps05211  Renal cell carcinoma
pps05212  Pancreatic cancer
pps05220  Chronic myeloid leukemia
pps05225  Hepatocellular carcinoma
pps05226  Gastric cancer
pps05321  Inflammatory bowel disease
pps05323  Rheumatoid arthritis
pps05410  Hypertrophic cardiomyopathy
pps05414  Dilated cardiomyopathy
pps05415  Diabetic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100980947 (TGFB1)
   04350 TGF-beta signaling pathway
    100980947 (TGFB1)
   04390 Hippo signaling pathway
    100980947 (TGFB1)
   04068 FoxO signaling pathway
    100980947 (TGFB1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100980947 (TGFB1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100980947 (TGFB1)
   04218 Cellular senescence
    100980947 (TGFB1)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    100980947 (TGFB1)
   04672 Intestinal immune network for IgA production
    100980947 (TGFB1)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    100980947 (TGFB1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100980947 (TGFB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100980947 (TGFB1)
   05205 Proteoglycans in cancer
    100980947 (TGFB1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100980947 (TGFB1)
   05212 Pancreatic cancer
    100980947 (TGFB1)
   05225 Hepatocellular carcinoma
    100980947 (TGFB1)
   05226 Gastric cancer
    100980947 (TGFB1)
   05220 Chronic myeloid leukemia
    100980947 (TGFB1)
   05211 Renal cell carcinoma
    100980947 (TGFB1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100980947 (TGFB1)
   05161 Hepatitis B
    100980947 (TGFB1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100980947 (TGFB1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100980947 (TGFB1)
   05144 Malaria
    100980947 (TGFB1)
   05145 Toxoplasmosis
    100980947 (TGFB1)
   05140 Leishmaniasis
    100980947 (TGFB1)
   05142 Chagas disease
    100980947 (TGFB1)
  09163 Immune disease
   05323 Rheumatoid arthritis
    100980947 (TGFB1)
   05321 Inflammatory bowel disease
    100980947 (TGFB1)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    100980947 (TGFB1)
   05414 Dilated cardiomyopathy
    100980947 (TGFB1)
   05415 Diabetic cardiomyopathy
    100980947 (TGFB1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100980947 (TGFB1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100980947 (TGFB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:pps03110]
    100980947 (TGFB1)
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pps04052]
    100980947 (TGFB1)
   00536 Glycosaminoglycan binding proteins [BR:pps00536]
    100980947 (TGFB1)
Chaperones and folding catalysts [BR:pps03110]
 Intramolecular chaperones
  Others
   100980947 (TGFB1)
Cytokines and growth factors [BR:pps04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   100980947 (TGFB1)
Glycosaminoglycan binding proteins [BR:pps00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   100980947 (TGFB1)
SSDB
Motif
Pfam: TGFb_propeptide TGF_beta
Other DBs
NCBI-GeneID: 100980947
NCBI-ProteinID: XP_003812507
UniProt: A0A2R9AI79
Position
19
AA seq 390 aa
MPPSGLRLLPLLLPLLWLLVLTPGRPAAGLSTCKTIDMELVKRKRIEAIRGQILSKLRLA
SPPSQGEVPPGPLPEAVLALYNSTRDRVAGESAEPEPEPEADYYAKEVTRVLMVETHNEI
YDKFKQSTHSIYMFFNTSELREAVPEPVLLSRAELRLLRLKLKVEQHVELYQKYSNNSWR
YLSNRLLAPSDSPEWLSFDVTGVVRQWLSRGGEMEGFRLSAHCSCDSRDNTLQVDINGFT
TGRRGDLATIHGMNRPFLLLMATPLERAQHLQSSRHRRALDTNYCFSSTEKNCCVRQLYI
DFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQA
LEPLPIVYYVGRKPKVEQLSNMIVRSCKCS
NT seq 1173 nt   +upstreamnt  +downstreamnt
atgccgccctccgggctgcggctgctgccgctgctgctaccgctgctgtggctactggtg
ctgacgcctggccggccggccgcgggactatccacctgcaagactatcgacatggagctg
gtgaagcggaagcgcatcgaggccatccgcggccagatcctgtccaagctgcggctcgcc
agccccccgagccagggggaggtgccgcccggcccgctgcccgaggccgtgcttgccctg
tacaacagcacccgcgaccgggtggccggggagagtgcagaaccggagcccgagcctgag
gccgactactacgccaaggaggtcacccgcgtgctaatggtggaaacccacaacgaaatc
tatgacaagttcaagcagagtacacacagcatatatatgttcttcaacacatcagagctc
cgagaagcggtacctgaacccgtgttgctctcccgggcagagctgcgtctgctgaggctc
aagttaaaagtggagcagcacgtggagctgtaccagaaatacagcaacaattcctggcga
tacctcagcaaccggctgctggcacccagcgactcgccagagtggttatcttttgatgtc
accggagttgtgcggcagtggttgagccgcggaggggaaatggagggctttcgccttagc
gcccactgctcctgtgacagcagggataacacactgcaagtggacatcaacgggttcact
accggccgccgaggtgacctggccaccattcacggcatgaaccggcctttcctgcttctc
atggccaccccgctggagagggcccagcatctgcaaagctcccggcaccgccgagccctg
gacaccaactattgcttcagctccacggagaagaactgctgcgtgcggcagctgtacatt
gacttccgcaaggacctcggctggaagtggatccacgagcccaagggctaccatgccaac
ttctgcctcgggccctgcccctacatttggagcctggacacgcagtacagcaaggtcctg
gccctgtacaaccagcataacccgggcgcctcggcggcgccgtgctgcgtgccgcaggcg
ctggagccgctgcccatcgtgtactacgtgggccgcaagcccaaggtggagcagctgtcc
aacatgatcgtgcgctcctgcaagtgcagctga

DBGET integrated database retrieval system