KEGG   Pan paniscus (bonobo): 100980993
Entry
100980993         CDS       T02283                                 

Gene name
DRD2
Definition
(RefSeq) dopamine receptor D2
  KO
K04145  dopamine receptor D2
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04015  Rap1 signaling pathway
pps04024  cAMP signaling pathway
pps04080  Neuroactive ligand-receptor interaction
pps04540  Gap junction
pps04728  Dopaminergic synapse
pps05012  Parkinson disease
pps05030  Cocaine addiction
pps05034  Alcoholism
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100980993 (DRD2)
   04024 cAMP signaling pathway
    100980993 (DRD2)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100980993 (DRD2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100980993 (DRD2)
 09150 Organismal Systems
  09156 Nervous system
   04728 Dopaminergic synapse
    100980993 (DRD2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05012 Parkinson disease
    100980993 (DRD2)
  09165 Substance dependence
   05030 Cocaine addiction
    100980993 (DRD2)
   05034 Alcoholism
    100980993 (DRD2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:pps04030]
    100980993 (DRD2)
G protein-coupled receptors [BR:pps04030]
 Rhodopsin family
  Biogenic amine
   Dopamine
    100980993 (DRD2)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4 7TM_GPCR_Srv DUF2207 RIFIN Stevor
Other DBs
NCBI-GeneID: 100980993
NCBI-ProteinID: XP_008969976
UniProt: A0A2R9A8Q0
Position
11
AA seq 443 aa
MDPLNLSWYDDDLERQNWSRPFNGSDGKADRPHYNYYATLLTLLIAVIVFGNVLVCMAVS
REKALQTTTNYLIVSLAVADLLVATLVMPWVVYLEVVGEWKFSRIHCDIFVTLDVMMCTA
SILNLCAISIDRYTAVAMPMLYNTRYSSKRRVTVMISIVWVLSFTISCPLLFGLNNADQN
ECIIANPAFVVYSSIVSFYVPFIVTLLVYIKIYIVLRRRRKRVNTKRSSRAFRAHLRAPL
KGNCTHPEDMKLCTVIMKSNGSFPVNRRRVEAARRAQELEMEMLSSTSPPERTRYSPIPP
SHHQLTLPDPSHHGLHSTPDSPAKPEKNGHAKDHPKIAKIFEIQTMPNGKTRTSLKTMSR
RKLSQQKEKKATQMLAIVLGVFIICWLPFFITHILNIHCDCNIPPVLYSAFTWLGYVNSA
VNPIIYTTFNIEFRKAFLKILHC
NT seq 1332 nt   +upstreamnt  +downstreamnt
atggatccactgaatctgtcctggtatgatgatgatctggagaggcagaactggagccgg
cccttcaacgggtcagacgggaaggcggacagaccccactacaactactatgccacactg
ctcaccctgctcatcgctgtcattgtcttcggcaacgtgctggtgtgcatggctgtgtcc
cgcgagaaggcgctgcagaccaccaccaactacctgatcgtcagcctcgcagtggccgac
ctccttgtcgccacactggtcatgccctgggttgtctacctggaggtggtaggtgagtgg
aaattcagcaggattcactgtgacatcttcgtcactctggacgtcatgatgtgcacggcg
agcatcctgaacttgtgtgccatcagcatcgacaggtacacagctgtggccatgcccatg
ctgtacaatacgcgctacagctccaagcgccgggtcaccgtcatgatctccatcgtctgg
gtcctgtccttcaccatctcctgcccactcctcttcggactcaataacgcagaccagaac
gagtgcatcattgccaacccggccttcgtggtctactcctccatcgtctccttctacgtg
cccttcattgtcaccctgctggtctacatcaagatctacattgtcctccgcagacgccgc
aagcgagtcaacaccaaacgcagcagccgagctttcagggcccacctgagggctccacta
aagggcaactgtactcaccccgaggacatgaaactctgcaccgttatcatgaagtctaat
gggagtttcccagtgaacaggcggagagtggaggctgcccggcgagcccaggagctggag
atggagatgctctccagcaccagcccacccgagaggacccggtacagccccatcccaccc
agccaccaccagctgactctccccgacccatcccaccacggtctccacagcactcccgac
agccccgccaaaccagagaagaatgggcatgccaaagaccaccccaagattgccaagatc
tttgagatccagaccatgcccaatggcaaaacccggacctccctcaagaccatgagccgt
aggaagctctcccagcagaaggagaagaaagccactcagatgctcgccattgttctcggc
gtgttcatcatctgctggctgcccttcttcatcacacacatcctgaacatacactgtgac
tgcaacatcccacctgtcctgtacagcgccttcacgtggctgggctatgtcaacagcgcc
gtgaaccccatcatctacaccaccttcaacattgagttccgcaaggccttcctgaagatc
ctccactgctga

DBGET integrated database retrieval system