KEGG   Pan paniscus (bonobo): 100981073
Entry
100981073         CDS       T02283                                 

Gene name
GABRA4
Definition
(RefSeq) gamma-aminobutyric acid type A receptor alpha4 subunit
  KO
K05175  gamma-aminobutyric acid receptor subunit alpha
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04080  Neuroactive ligand-receptor interaction
pps04723  Retrograde endocannabinoid signaling
pps04727  GABAergic synapse
pps04742  Taste transduction
pps05032  Morphine addiction
pps05033  Nicotine addiction
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100981073 (GABRA4)
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    100981073 (GABRA4)
   04723 Retrograde endocannabinoid signaling
    100981073 (GABRA4)
  09157 Sensory system
   04742 Taste transduction
    100981073 (GABRA4)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    100981073 (GABRA4)
   05033 Nicotine addiction
    100981073 (GABRA4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:pps04040]
    100981073 (GABRA4)
Ion channels [BR:pps04040]
 Ligand-gated channels
  GABA-A
   100981073 (GABRA4)
SSDB
Motif
Pfam: Neur_chan_LBD Neur_chan_memb OAD_gamma
Other DBs
NCBI-GeneID: 100981073
NCBI-ProteinID: XP_003816071
UniProt: A0A2R9C6M3
Position
4
AA seq 554 aa
MVSAKKVPAIALSAGVSFALLRFLCLAVCLNESPGQNQKEEKLCTENFTRILDSLLDGYD
NRLRPGFGGPVTEVKTDIYVTSFGPVSDVEMEYTMDVFFRQTWIDKRLKYDGPIEILRLN
NMMVTKVWTPDTFFRNGKKSVSHNMTAPNKLFRIMRNGTILYTMRLTISAECPMRLVDFP
MDGHACPLKFGSYAYPKSEMIYTWTKGPEKSVEVPKESSSLVQYDLIGQTVSSETIKSIT
GEYIVMTVYFHLRRKMGYFMIQTYIPCIMTVILSQVSFWINKESVPARTVFGITTVLTMT
TLSISARHSLPKVSYATAMDWFIAVCFAFVFSALIEFAAVNYFTNIQMEKAKRKTSKPPQ
EVPAAPVQREKHPEAPLQNTNANLNMRKRTNALVHSESDVGNRTEVGNHSSKSSTVVQES
SKGTPRSYLASSPNPFSRANAAETISAARALPSASPTSIRTGYMPRKASVGSASTRHVFG
SRLQRIKTTVNTIGATGKLSATPPPSTPPPSGSGTSKIDKYARILFPVTFGAFNMVYWVV
YLSKDTMEKSESLM
NT seq 1665 nt   +upstreamnt  +downstreamnt
atggtttctgccaagaaggtacccgcgatcgctctgtccgccggggtcagtttcgccctc
ctgcgtttcctgtgcctggcggtttgtttaaacgaatccccaggacagaaccaaaaggag
gagaaattgtgcacagaaaatttcacccgcatcctggacagtttgctcgatggttatgac
aacaggctgcgtcctggatttgggggtcctgttacagaagtgaaaactgacatatatgtc
accagctttggacctgtttctgatgttgaaatggaatacacaatggatgtgttcttcaga
cagacatggattgacaaaagattaaaatatgacggccccattgaaattttgagattgaac
aatatgatggtaacgaaagtgtggacccctgatactttcttcaggaatggaaagaaatct
gtctcacataatatgacagctccaaataagctttttagaattatgagaaatggtactatt
ttatacacaatgagactcaccataagtgcggagtgtcccatgagattggtggattttccc
atggatggtcatgcatgccctttgaaattcgggagttatgcctatccaaagagtgagatg
atctatacctggacaaaaggtcctgagaaatcagttgaagttccgaaggagtcttccagc
ttagttcaatatgatttgattgggcaaaccgtatcaagtgaaaccatcaaatcaattacg
ggtgaatatattgttatgacggtttacttccacctcagacggaagatgggttattttatg
attcagacctatattccatgcattatgacagtgattctttctcaagtttcattttggata
aataaagaatcagttcctgctaggactgtatttggaataacaactgtcctcaccatgacc
acactaagcatcagtgcacgacattctttgcccaaagtgtcctatgctaccgccatggac
tggttcatagctgtctgctttgcttttgtattttcggcccttatcgagtttgctgctgtc
aactatttcaccaatattcaaatggaaaaagccaaaaggaagacatcaaaaccccctcag
gaagttcccgctgctccagtgcagagagagaagcatcctgaagcccctctgcagaataca
aatgccaatttgaacatgagaaaaagaacaaatgctttggttcactctgaatctgatgtt
ggcaacagaactgaggtgggaaaccattcaagcaaatcttccacagttgttcaagaatct
tctaaaggcacacctcggtcttacttagcttccagtccaaacccattcagccgtgcaaat
gcagctgaaaccatatctgcagcaagagcacttccatctgcttctcctacttctatccga
actggatatatgcctcgaaaggcttcagttggatctgcttctactcgtcacgtgtttgga
tcaagactgcagaggataaagaccacagttaataccataggggctactgggaagttgtca
gctactcctcctccatcgactccaccaccttctggatctggcacaagtaaaatagacaaa
tatgcccgtattctctttccagtcacatttggggcatttaacatggtttattgggttgtt
tatttatctaaggacactatggagaaatcagaaagtctaatgtaa

DBGET integrated database retrieval system