KEGG   Pan paniscus (bonobo): 100981087
Entry
100981087         CDS       T02283                                 

Gene name
CCL2
Definition
(RefSeq) C-C motif chemokine ligand 2
  KO
K14624  C-C motif chemokine 2
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04060  Cytokine-cytokine receptor interaction
pps04061  Viral protein interaction with cytokine and cytokine receptor
pps04062  Chemokine signaling pathway
pps04621  NOD-like receptor signaling pathway
pps04657  IL-17 signaling pathway
pps04668  TNF signaling pathway
pps04933  AGE-RAGE signaling pathway in diabetic complications
pps05135  Yersinia infection
pps05142  Chagas disease
pps05144  Malaria
pps05163  Human cytomegalovirus infection
pps05164  Influenza A
pps05168  Herpes simplex virus 1 infection
pps05171  Coronavirus disease - COVID-19
pps05323  Rheumatoid arthritis
pps05417  Lipid and atherosclerosis
pps05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    100981087 (CCL2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100981087 (CCL2)
   04061 Viral protein interaction with cytokine and cytokine receptor
    100981087 (CCL2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    100981087 (CCL2)
   04657 IL-17 signaling pathway
    100981087 (CCL2)
   04062 Chemokine signaling pathway
    100981087 (CCL2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    100981087 (CCL2)
   05164 Influenza A
    100981087 (CCL2)
   05168 Herpes simplex virus 1 infection
    100981087 (CCL2)
   05163 Human cytomegalovirus infection
    100981087 (CCL2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100981087 (CCL2)
  09174 Infectious disease: parasitic
   05144 Malaria
    100981087 (CCL2)
   05142 Chagas disease
    100981087 (CCL2)
  09163 Immune disease
   05323 Rheumatoid arthritis
    100981087 (CCL2)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100981087 (CCL2)
   05418 Fluid shear stress and atherosclerosis
    100981087 (CCL2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100981087 (CCL2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pps04052]
    100981087 (CCL2)
   00536 Glycosaminoglycan binding proteins [BR:pps00536]
    100981087 (CCL2)
Cytokines and growth factors [BR:pps04052]
 Cytokines
  Chemokines
   100981087 (CCL2)
Glycosaminoglycan binding proteins [BR:pps00536]
 Heparan sulfate / Heparin
  Chemokines
   100981087 (CCL2)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 100981087
NCBI-ProteinID: XP_003818057
UniProt: A0A2R9ARC2
Position
17
AA seq 99 aa
MKVSAALLCLLLIAATFIPQGLAQPDAINAPVTCCYNFTNRKISVQRLASYRRITSSKCP
KEAVIFKTVVAKEICADPKQKWVQDSMDHLDKQTQTPKT
NT seq 300 nt   +upstreamnt  +downstreamnt
atgaaagtctctgccgcgcttctgtgcctgctgctcatagcagccaccttcattccccag
gggctcgctcagccagatgcaatcaatgccccagtcacctgctgctataacttcaccaat
aggaagatctcagtgcagaggctggcgagctatagaagaatcaccagcagcaagtgtccc
aaagaagctgtgatcttcaagaccgttgtggccaaggagatctgtgctgaccccaagcag
aagtgggttcaggattccatggaccacctggacaagcaaacccaaactccgaagacttga

DBGET integrated database retrieval system