KEGG   Pan paniscus (bonobo): 100981333
Entry
100981333         CDS       T02283                                 

Gene name
EIF2AK3
Definition
(RefSeq) eukaryotic translation initiation factor 2 alpha kinase 3
  KO
K08860  eukaryotic translation initiation factor 2-alpha kinase 3 [EC:2.7.11.1]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04137  Mitophagy - animal
pps04140  Autophagy - animal
pps04141  Protein processing in endoplasmic reticulum
pps04210  Apoptosis
pps04932  Non-alcoholic fatty liver disease
pps05010  Alzheimer disease
pps05012  Parkinson disease
pps05014  Amyotrophic lateral sclerosis
pps05020  Prion disease
pps05022  Pathways of neurodegeneration - multiple diseases
pps05160  Hepatitis C
pps05162  Measles
pps05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:pps00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100981333 (EIF2AK3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100981333 (EIF2AK3)
   04137 Mitophagy - animal
    100981333 (EIF2AK3)
  09143 Cell growth and death
   04210 Apoptosis
    100981333 (EIF2AK3)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100981333 (EIF2AK3)
   05012 Parkinson disease
    100981333 (EIF2AK3)
   05014 Amyotrophic lateral sclerosis
    100981333 (EIF2AK3)
   05020 Prion disease
    100981333 (EIF2AK3)
   05022 Pathways of neurodegeneration - multiple diseases
    100981333 (EIF2AK3)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100981333 (EIF2AK3)
  09172 Infectious disease: viral
   05162 Measles
    100981333 (EIF2AK3)
   05160 Hepatitis C
    100981333 (EIF2AK3)
   05168 Herpes simplex virus 1 infection
    100981333 (EIF2AK3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pps01001]
    100981333 (EIF2AK3)
Enzymes [BR:pps01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100981333 (EIF2AK3)
Protein kinases [BR:pps01001]
 Serine/threonine kinases: Other
  PEK family [OT]
   100981333 (EIF2AK3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PQQ_2 Kinase-like Kdo APH
Other DBs
NCBI-GeneID: 100981333
NCBI-ProteinID: XP_003805899
UniProt: A0A2R9BQ98
Position
2A
AA seq 1115 aa
MERAISPGLLVRALLLLLLLLGLAARTVAAGRARGLPAPTAEAAFGLGAAAAPTSATRVP
AAGAVAAAEVTVEDAEALPAAAGEQEPRGPEPDDETELQPRGRSLVIISTLDGRIAALDP
ENHGKKQWDLDVGSGSLVSSSLSKPEVFGNKMIIPSLDGDLFQWDRDRESMETVPFTVES
LLESSYKFGDDVVLVGGKSLTTYGLSAYSGKVRYICSALGCRQWDSDEMEQEEDILLLQR
TQKTVRAVGPRSGNEKWNFSVGHFELRYIPDMETRAGFIESTFKPNENTEESKIISDVEE
QEAAIMDIVIKVSVADWKVMAFSKKGGHLEWEYQFCTPIASAWLLKDGKVIPISLFDDTS
YTSNDDVLEDEEDIVEAARGATENSVYLGMYRGQLYLQSSVRISEKFPSSPKALESVNEN
AIIPLPTIKWKPLIHSPSRTPVLVGSDEFDKCLSNDKFSHEEYSNGALSILQYPYDNGYY
LPYYKRERNKRSTQITVRFLDNPHYNKNIRKKDPVLLLHWWKEIVATILFCIIATTFIVR
RLFHPHPHRQRKESETQCQTENKYDSVSGEANDSSWNDIKNSGYISRYLTDFEPIQCLGR
GGFGVVFEAKNKVDDCNYAIKRIRLPNRELAREKVMREVKALAKLEHPGIVRYFNAWLEA
PPEKWQEKMDEIWLKDESTDWPLSSPSPMDAPSVKIRRMDPFSTKEHIEIIAPSPQRSRS
FSVGISCDQTSSSESQFSPLEFSGMDHEDISESVDAAYNLQDSCLTDCDVEDGTMDGNDE
GHSFELCPSEASPYVRSRERTSSSIVFEDSGCDNASSKEEPKTNRLHIGNHCANKLTAFK
PTSSKSSSEATLSISPPRPTTLSLDLTKNTTEKLQPSSPKVYLYIQMQLCRKENLKDWMN
GRCTIEERERSMCLHIFLQIAEAVEFLHSKGLMHRDLKPSNIFFTMDDVVKVGDFGLVTA
MDQDEEEQTVLTPMPAYARHTGQVGTKLYMSPEQIHGNSYSHKVDIFSLGLILFELLYPF
STQMERVRTLTDVRNLKFPPLFTQKYPCEYVMVQDMLSPSPMERPEAINIIENAVFEDLD
FPGKTVLRQRSRSLSSSGTKHSRQSNNSHSPLPSN
NT seq 3348 nt   +upstreamnt  +downstreamnt
atggagcgcgccatcagcccggggctgctggtacgggcgctgctgctgctgctgctgctg
ctggggctcgcggcaaggacggtggccgcggggcgcgcccgtggcctcccagcgccgacg
gcggaggcggcgttcggcctcggggcggccgctgctcccacctcagcgacgcgagtaccg
gcggcgggcgccgtggctgcggccgaggtgactgtggaggacgctgaggcgctgccggca
gccgcgggagagcaggagcctcggggtccggaaccagacgatgagacagagttgcaaccg
cgcggcaggtcattagtaattatcagcactttagatgggagaattgctgccttggatcct
gaaaatcatggtaaaaagcagtgggatttggatgtgggatccggttccttggtgtcatcc
agccttagcaaaccagaggtatttgggaataagatgatcattccttccctggatggagac
ctcttccagtgggaccgagaccgtgagagcatggaaacagttcctttcacagttgaatca
cttcttgaatcttcttataaatttggagatgatgttgttttggttggaggaaaatctctg
actacatatggactcagtgcatatagtggaaaggtgagatatatctgttcagctctgggt
tgtcgccaatgggatagtgacgaaatggaacaagaggaagacatcctgcttctacagcgt
acccaaaaaactgttagagctgtcggacctcgcagtggcaatgagaagtggaatttcagt
gttggccactttgaacttcggtatattccagacatggaaacgagagccggatttattgaa
agcacctttaagcccaatgagaacacagaagagtctaaaattatttcagatgtggaagaa
caggaagctgccataatggacatagtgataaaggtttcggttgctgactggaaagttatg
gcattcagtaagaagggaggacatctggaatgggagtaccagttttgtactccaattgca
tctgcctggttacttaaggatgggaaggtcattcccatcagtctttttgatgatacaagt
tatacatctaatgatgatgttttagaagatgaagaagacattgtagaagctgccagagga
gccacagaaaacagtgtttacttgggaatgtatagaggccagctgtatctgcagtcatca
gtcagaatttcagaaaagtttccttcaagtcccaaggctttggagtctgtcaatgaaaac
gcaattattcctttgccaacaatcaaatggaaacccttaattcattctccttccagaact
cctgtcttggtaggatctgatgaatttgacaaatgtctcagtaatgataagttttctcat
gaagaatatagtaatggtgcactttcaatcttgcagtatccgtatgataatggttattat
ctaccatactacaagagggaaaggaacaaacgaagcacacagattacagtcagattcctc
gacaacccacattacaacaagaatatccgcaaaaaggatcctgttcttcttttacactgg
tggaaagaaatagttgcaacgattttgttttgtatcatagcaacaacgtttattgtgcgc
aggcttttccatcctcatcctcacaggcaaaggaaggagtctgaaactcagtgtcaaact
gaaaataaatatgattccgtaagtggtgaagccaatgacagtagctggaatgacataaaa
aactctggatatatatcacgatatctaactgattttgagccaattcaatgcctgggacgt
ggtggctttggagttgtttttgaagctaaaaacaaagtagatgactgcaattatgctatc
aagaggatccgtctccccaatagggaattggctcgggaaaaggtaatgcgagaagttaaa
gccttagccaagcttgaacacccgggcattgttagatatttcaatgcctggctcgaagca
ccaccagagaagtggcaagaaaagatggatgaaatctggctgaaagatgaaagcacagac
tggccactcagctctcctagcccaatggatgcaccatcagttaaaatacgcagaatggat
cctttctctacaaaagaacatattgaaatcatagctccttcaccacaaagaagcaggtct
ttttcagtagggatttcctgtgaccagacaagttcatctgagagccagttctcaccactg
gaattctcaggaatggaccatgaggacatcagtgagtcagtggatgcagcatacaacctc
caggacagttgccttacagactgtgatgtggaagatgggactatggatggcaatgatgag
gggcactcctttgaactttgtccttctgaagcttctccttatgtaaggtcaagggagaga
acctcctcttcaatagtatttgaagattctggctgtgataatgcttccagtaaagaagag
ccgaaaactaatcgattgcatattggcaaccattgtgctaataaactaactgctttcaag
cccaccagtagcaaatcttcttctgaagctacattgtctatttctcctccgagaccaacc
actttaagtttagatctcactaaaaacaccacagaaaaactccagcccagttcaccaaag
gtgtatctttacattcaaatgcagctgtgcagaaaagaaaacctcaaagactggatgaat
ggacgatgtaccatagaggagagagagaggagcatgtgtctgcacatcttcctgcagatc
gcagaggcagtggagtttcttcacagtaaaggactgatgcacagggacctcaagccatcc
aacatattctttacaatggatgatgtggtcaaggttggagactttgggttagtgactgca
atggaccaggatgaggaagagcagacggttctgaccccaatgccagcttatgccagacac
acaggacaagtagggaccaaactgtatatgagcccagagcagattcatggaaacagctat
tctcataaagtggacatcttttctttaggcctgattctatttgaattgctgtatccattc
agcactcagatggagagagtcaggaccttaactgatgtaagaaatctcaaatttccacca
ttatttactcagaaatatccttgtgagtatgtgatggttcaagacatgctctctccatcc
cccatggaacgacctgaagctataaacatcattgaaaatgctgtatttgaggacttggac
tttccaggaaaaacagtgctcagacagaggtctcgctccttgagttcatcgggaacaaaa
cattcaagacagtccaacaactcccatagccctttgccaagcaattag

DBGET integrated database retrieval system