KEGG   Pan paniscus (bonobo): 100981698
Entry
100981698         CDS       T02283                                 

Gene name
HSPD1
Definition
(RefSeq) heat shock protein family D (Hsp60) member 1
  KO
K04077  chaperonin GroEL
Organism
pps  Pan paniscus (bonobo)
Pathway
pps03018  RNA degradation
pps04940  Type I diabetes mellitus
pps05134  Legionellosis
pps05152  Tuberculosis
pps05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pps00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    100981698 (HSPD1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05134 Legionellosis
    100981698 (HSPD1)
   05152 Tuberculosis
    100981698 (HSPD1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100981698 (HSPD1)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100981698 (HSPD1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:pps03019]
    100981698 (HSPD1)
   03110 Chaperones and folding catalysts [BR:pps03110]
    100981698 (HSPD1)
   03029 Mitochondrial biogenesis [BR:pps03029]
    100981698 (HSPD1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pps04147]
    100981698 (HSPD1)
Messenger RNA biogenesis [BR:pps03019]
 Prokaryotic type
  Bacterial mRNA degradation factors
   Other RNA degradation factors
    Chaperones
     100981698 (HSPD1)
Chaperones and folding catalysts [BR:pps03110]
 Heat shock proteins
  HSP60 / Chaperonin
   100981698 (HSPD1)
Mitochondrial biogenesis [BR:pps03029]
 Mitochondrial protein import machinery
  Matrix
   Other matrix factors
    100981698 (HSPD1)
Exosome [BR:pps04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100981698 (HSPD1)
  Exosomal proteins of other body fluids (saliva and urine)
   100981698 (HSPD1)
  Exosomal proteins of breast cancer cells
   100981698 (HSPD1)
  Exosomal proteins of colorectal cancer cells
   100981698 (HSPD1)
  Exosomal proteins of bladder cancer cells
   100981698 (HSPD1)
SSDB
Motif
Pfam: Cpn60_TCP1 EAD9
Other DBs
NCBI-GeneID: 100981698
NCBI-ProteinID: XP_003825353
Position
2B
AA seq 573 aa
MLRLPTVFRQMRPVSRVLAPHLTRAYAKDVKFGADARALMLQGVDLLADAVAVTMGPKGR
TVIIEQSWGSPKVTKDGVTVAKSIDLKDKYKNIGAKLVQDVANNTNEEAGDGTTTATVLA
RSIAKEGFEKISKGANPVEIRRGVMLAVDAVIAELKKQSKPVTTPEEIAQVATISANGDK
EIGNIISDAMKKVGRKGVITVKDGKTLNDELEIIEGMKFDRGYISPYFINTSKGQKCEFQ
DAYVLLSEKKISSVQSIVPALEIANAHRKPLVIIAEDVDGEALSTLVLNRLKVGLQVVAV
KAPGFGDNRKNQLKDMAIATGGAVFGEEGLTLNLEDVQPHDLGKVGEVIVTKDDAMLLKG
KGDKAQIEKRIQEIIEQLDVTTSEYEKEKLNERLAKLSDGVAVLKVGGTSDVEVNEKKDR
VTDALNATRAAVEEGIVLGGGCALLRCIPALDSLTPANEDQKIGIEIIKRTLKIPAMTIA
KNAGVEGSLIVEKIMQSSSEVGYDAMAGDFVNMVEKGIIDPTKVVRTALLDAAGVASLLT
TAEVVVTEIPKEEKDPGMGAMGGMGGGMGGGMF
NT seq 1722 nt   +upstreamnt  +downstreamnt
atgcttcggttacccacagtctttcgccagatgagaccggtgtccagggtactggctcct
catctcactcgggcttatgccaaagatgtaaaatttggtgcagatgcccgagccttaatg
cttcaaggtgtagaccttttagccgatgctgtggccgttacaatggggccaaagggaaga
acagtgattattgagcagagttggggaagtcccaaagtaacaaaagatggtgtgactgtt
gcaaagtcaattgacttaaaagataaatacaaaaacattggagctaaacttgttcaagat
gttgccaataacacaaatgaagaagctggggatggcactaccactgctactgtactggca
cgctctatagccaaggaaggcttcgagaagattagcaaaggtgctaatccagtggaaatc
aggagaggtgtgatgttagctgttgatgctgtaattgctgaacttaaaaagcagtctaaa
cctgtgaccacccctgaagaaattgcacaggttgctacgatttctgcaaacggagacaaa
gaaattggcaatatcatctctgatgcaatgaaaaaagttggaagaaagggtgtcatcaca
gtaaaggatggaaaaacactgaatgatgaattagaaattattgaaggcatgaagtttgat
cgaggctatatttctccatactttattaatacatcaaaaggtcagaaatgtgaattccag
gatgcctatgttctgttgagtgaaaagaaaatttctagtgtccagtccattgtacctgct
cttgaaattgccaatgctcaccgtaagcctttggtcataatcgctgaagatgttgatgga
gaagctctaagtacactcgtcttgaataggctaaaggttggtcttcaggttgtggcagtc
aaggctccagggtttggtgacaatagaaagaaccagcttaaagatatggctattgctact
ggtggtgcagtgtttggagaagagggattgaccctgaatcttgaagacgttcagcctcat
gacttaggaaaagttggagaggtcattgtgaccaaagacgatgccatgctcttaaaagga
aaaggtgacaaggctcaaattgaaaaacgtattcaagaaatcattgagcagttagatgtc
acaactagtgaatatgaaaaggaaaaactgaatgaacggctcgcaaaactttcagatgga
gtggctgtgctgaaggttggtgggacaagtgatgttgaagtgaatgaaaagaaagacaga
gttacagatgcccttaatgctacaagagctgctgttgaagaaggcattgttttgggaggg
ggttgtgccctccttcgatgcattccagccttggactcattgactccagctaatgaagat
caaaaaattggtatagaaattattaaaagaacactcaaaattccagcaatgaccattgct
aagaatgcaggtgttgaaggatctttgatagttgagaaaattatgcaaagttcctcagaa
gttggttatgatgctatggctggagattttgtgaatatggtggaaaaaggaatcattgac
ccaacaaaggttgtgagaactgctttattggatgctgctggtgtggcctctctgttaact
acagcagaagttgtagtcacagaaattcctaaagaagagaaggaccctggaatgggtgca
atgggtggaatgggaggtggtatgggaggtggcatgttctaa

DBGET integrated database retrieval system