KEGG   Pan paniscus (bonobo): 100981990
Entry
100981990         CDS       T02283                                 

Gene name
MYO9A
Definition
(RefSeq) myosin IXA
  KO
K10360  myosin IX
Organism
pps  Pan paniscus (bonobo)
Brite
KEGG Orthology (KO) [BR:pps00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pps04131]
    100981990 (MYO9A)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:pps04812]
    100981990 (MYO9A)
Membrane trafficking [BR:pps04131]
 Others
  Rho GTPase associated proteins
   Rho GTPase-activating proteins
    100981990 (MYO9A)
Cytoskeleton proteins [BR:pps04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     100981990 (MYO9A)
SSDB
Motif
Pfam: Myosin_head RhoGAP RA IQ C1_1 AAA_22 AAA_16 T2SSE
Other DBs
NCBI-GeneID: 100981990
NCBI-ProteinID: XP_003818596
UniProt: A0A2R9BBY5
Position
15
AA seq 2548 aa
MNINDGGRRRFEDNEHTLRIYPGTISEGTIYCPIPARKNSTAAEVIESLINKLHLDKTKC
YVLAEVKEFGGEEWILNPTDCPVQRMMLWPRMALENRLSGEDYRFLLREKNLDGSIHYGS
LQSWLRVTEERRRMMERGFLPQPQQKDFDDLCSLPDLNEKTLLENLRNRFKHEKIYTYVG
SILIVINPFKFLPIYNPKYVKMYDNHQLGKLEPHIYAVADVAYHAMLQRKKNQCIVISGE
SGSGKTQSTNFLIHHLTALSQKGFASGVEQIILGAGPVLEAFGNAKTAHNNNSSRFGKFI
QVNYQETGTVLGAYVEKYLLEKSRLVYQEHNERNYHVFYYLLAGASEDERSAFHLKQPEE
YHYLNQITKKPLRQSWDDYCYDSEPDCFTVEGEDLRHDFERLQLAMEMVGFLPKTRRQIF
SLLSAILHLGNICYKKKTYRDDSIDICNPEVLPIVSELLEVKEEMLFEALVTRKTVTVGE
KLILPYKLAEAVTVRNSMAKSLYSALFDWIVFRINHALLNSKDLEHNTKTLSIGVLDIFG
FEDYENNSFEQFCINFANERLQHYFNQHIFKLEQEEYRTEGISWHNIDYIDNTCCINLIS
KKPTGLLHLLDEESNFPQATNQTLLDKFKHQHEDNSYIEFPAVMEPAFIIKHYAGKVKYG
VKDFREKNTDHMRPDIVALLRSSKNAFISGMIGIDPVAVFRWAILRAFFRAIVAFREAGK
RNIHRKTGHDDTAPCAILKSMDSFSFLQHPVHQRSLEILQRCKEEKYSITRKNPRTPLSD
LQGMNALNEKNQHDTFDIAWNGRTGIRQSRLSSGTSLLDKDGIFANSTSSKLLERAHGIL
TRNKNFKSKPALPKHLLEVNSLKHLTRLTLQDRITKSLLHLHKKKKPPSISAQFQASLSK
LMETLGQAEPYFVKCIRSNAEKLPLRFNDVLVLRQLRYTGMLETVRIRQSGYSSKYSFQD
FVSHFHVLLPRNIIPSKFNIQDFFRKINLNPDNYQVGKTMVFLKEQERQHLQDLLHQEVL
RRIILLQRWFRVLLCRQHFLHLRQASVIIQRFWRNYLNQKQVRDAAVQKDAFVMASAAAL
LQASWRAHLERQRYLELRAAAIVIQQKWRDYYRRRHMAAICIQARWKAYRESKRYQEQRK
KLYLLQSTCRGFRARQRFKALKEQRLRETKPEVGLVNIKGYGSLEIQGSDPSEWEDCSFD
NRIKAIEECKSVIDSNRISRESSVDCLKESPNKQQERAQSQSGVDLQEDVLVRERPRSLE
DLHQKKVGRAKRESRRMRELEQAIFSLELLKVRSLGGISPSEDRRWSTELVPEGLQSPRG
TPDSESSQGSLELLSYEESQKSKLESVISDEGDLQFPSPKISSSPKFDSRDNALSASNET
SNAEHLKDGTMKEKVVCSSESITCKPQLKDSFISNSLPTFFYIPQQDPLKTNSQLDTSIQ
RNKLLENEDTAGEALTLDINRETRRYHCSGKDQIVPSLNTESSNPVLKKLEKLNTEKEER
QKQLQQQNEKEMMEQIRQQTDILEKERKAFKTIEKPRIGECLVAPSSYQSKQRVERPSSL
LSLNTSNKGELNVLGSLSLKDAALAQKDSSSAHLPPKDRPVTVFFERKGSPCQSSTVKEL
SKTDRMGTQLNVACKLSNNRISKREHFRPTQSYSHNSDDLSREGNARPIFFTPKDNMSIP
LVSKEAVNSENPQLHKEDEPAWKPVKLAGPGQRETSQRFSSVDEQAKLHKTMSQGEITKL
AVRQKASDSDIRPQRAKMRFWAKGKQGEKKTTRVKPTTQSEVSPLFAGTDVIPAHQFPDE
LAAYHPTPPLSPELPGSCRKEFKENKEPSPKAKRKRSVKISNVALDSMHWQNDSVQIIAS
VSDLKSMDEFLLKKVNDLDNEDSKKDTLVDVVFKKALKEFRQNIFSFYSSALAMDDGKSI
RYKDLYALFEQILEKTMRLEQRDSLGESPVRVWVNTFKVFLDEYMNEFKTSDCTATKVPK
TERKKRRKKETDLVEEHNGHIFKATQYSIPTYCEYCSSLIWIMDRASVCKLCKYACHKKC
CLKTTAKCSKKYDPELSSRQFGVELSRLTSEDRTVPLVVEKLINYIEMHGLYTEGIYRKS
GSTNKIKELRQGLDTDAESVNLDDYNIHVIASVFKQWLRDLPNPLMTFELYEEFLRAMGL
QERKETIRGVYSVIDQLSRTHLNTLERLIFHLVRIALQEDTNRMSANALAIVFAPCILRC
PDTTDPLQSVQDISKTTTCVELIVVEQMNKYKARLKDISSLEFAENKAKTRLSLIRRSMG
KGRIRRGNYPGPSSPVVVRLPSVSDVSEETLTSEAAMETDITEQQQAAMQQEERVLTEQI
ENLQKEKEELTFEMLVLEPRASDDETLESEASIGTADSSENLNMESECAISEKSERSLAL
SSLKTAGKSEPSSKLRKQVKKQQDSLDVVDSSVSSLCLSNTASSHGTRKLFQIYSKSPFY
RAASGNEALGMEGPLGQTKFLEDKPQFISRGTFNPEKGKQKLKTVKNSPQKTKETPEGTV
MSGRRKTVDPDCTSNQQLALFGNNEFMV
NT seq 7647 nt   +upstreamnt  +downstreamnt
atgaatataaatgatggaggaagacgacgctttgaagataatgaacatacattacggata
tatcctgggactatttcagaagggacaatctactgtccgattcctgccagaaaaaactcc
acagctgctgaggtgattgagtctcttataaacaaacttcatcttgacaaaacaaaatgt
tatgttctagcagaggtaaaggaatttggtggagaagaatggattctcaatccaacagat
tgtccagttcagcgaatgatgttgtggccccgaatggctctggaaaatcgcttaagtgga
gaggactaccgcttccttctgagagagaaaaaccttgatggatcaatccattatggtagc
ctgcagtcatggctacgggtaacagaagaacgtcgcaggatgatggaacggggttttctt
ccacagcctcagcagaaagactttgatgatttatgtagtttacctgatttgaatgagaaa
actctcttagaaaacctacgaaatcgctttaagcatgaaaaaatttatacctatgttggc
agtattctaatagttattaacccattcaagtttcttcctatttataaccccaaatatgtc
aaaatgtatgataaccaccaactgggaaaacttgagccccacatttatgctgtggctgat
gtagcttatcatgccatgcttcagcgcaaaaagaatcagtgcatcgtgatttcaggagag
agtggttctgggaagactcaaagcacaaactttcttattcaccaccttactgctctcagt
cagaaaggatttgccagtggagtagaacagattattcttggagctggaccagtacttgag
gcctttggaaatgcaaagacagctcataataacaattcaagtcgttttgggaagtttatt
caagtaaattaccaggaaacaggcactgtacttggtgcctatgttgaaaaatatctactg
gagaagtctagactcgtttatcaggagcataatgaacggaactatcatgtattctattac
ctcctggcaggagcaagtgaagatgagagatcagcattccatcttaagcaaccagaggaa
tatcattatctcaatcagataacaaagaaacccctcagacagagctgggatgattattgc
tatgactctgagccggattgcttcacggtggaaggggaagatttgagacatgactttgag
cgcctacaacttgccatggaaatggtaggatttcttcccaagacacgaagacagattttc
tctcttctctcagccatactacatttgggtaatatctgttacaaaaagaagacataccgg
gatgactccattgatatctgtaatcctgaagttctgcctattgtctcagaattattagag
gttaaagaagagatgctatttgaagcattagttacaaggaagacggtgacagtgggagaa
aagcttattctgccatacaagttggcagaggctgtgacagtgaggaactccatggctaag
tctctatatagtgccctgtttgactggatagtttttcgaattaatcatgcactcctgaat
agtaaagatttagagcataataccaagacattgtctattggagttcttgatatttttggg
tttgaagattatgaaaataacagctttgaacagttctgtattaattttgctaatgaacgt
ttacagcactactttaatcagcatatctttaaattggaacaagaggaatatagaactgaa
ggtatcagctggcacaacatagattacattgataatacctgctgcataaatcttattagc
aaaaaaccaacaggactgcttcatcttttggatgaagaaagcaactttccacaggctaca
aatcaaacattgctagacaagtttaagcatcaacatgaagataattcttacatcgaattt
ccagccgtgatggagcctgctttcattataaaacattatgctggaaaagtaaaatatggg
gtaaaggatttccgggaaaaaaatacagatcatatgcgcccagacattgtagctcttctg
agaagcagcaagaatgcatttatttctgggatgattggaattgatcctgtagctgttttc
cgatgggcaattctccgagcttttttcagagccatagttgctttcagggaagctgggaaa
agaaacattcacagaaaaactggacatgatgatacagcgccatgtgcaattttgaaaagt
atggatagttttagctttctccaacacccagtccaccagaggagcttagagattctgcag
agatgcaaggaagagaagtacagtataacccggaaaaatcccagaacacctctttctgat
ctccagggcatgaatgctctaaatgaaaaaaaccaacatgatacatttgatattgcctgg
aatggcagaactgggattcgccagagcagactatcaagtggcacctccttgcttgataaa
gatggaatatttgctaattcaactagcagcaaactcctggagagagcccatggaattctc
acgagaaacaaaaatttcaaatccaagcctgcccttccaaagcacttgctagaagtaaat
tctttaaagcacctgacaagactgacactacaagatcgcattaccaagtctcttcttcat
ttacacaagaagaaaaaacctcccagcatcagtgcccagtttcaggcatcattaagcaag
ctaatggaaacacttggtcaagcagaaccatattttgtaaaatgcattcgctctaatgct
gaaaagctgcccttaaggttcaatgatgtcttggtacttagacagcttcgatacaccggg
atgctggaaacagttcgaattcgccaatcaggatacagctccaaatattctttccaggat
tttgtgagccacttccatgtacttcttccccgaaatattattccatccaaatttaacatt
caggatttcttcaggaaaataaatcttaatccagataattatcaagttggaaaaaccatg
gtctttctaaaggagcaggaacgacagcacttacaagatctgcttcaccaagaggtgctc
cgcagaatcatattgttgcagcgatggttcagggtcttgctgtgtaggcagcatttcctc
catctgagacaagcatctgttattatccagagattctggaggaattacctaaatcagaag
caagtcagagatgcagctgtgcagaaggatgcttttgttatggctagtgcggctgctctt
ctccaagcttcctggcgtgctcacttagagaggcagcggtacttggagttacgggctgca
gccatcgttatccagcagaaatggagagattactataggcgcaggcacatggctgctatt
tgcatacaagcaagatggaaagcctacagggaaagtaaaaggtaccaagaacaaaggaaa
aaattataccttttgcaatcaacatgtagaggattcagagcaagacaaagatttaaagct
ttaaaagaacaaaggctaagagaaacaaaaccagaagttggattggtgaatattaaggga
tatggatctctggaaattcagggttcagacccttcagaatgggaggattgttcttttgac
aacagaataaaagccatagaggaatgtaaatctgtaatagacagtaatcgaattagccgt
gaaagttcagtggactgcttgaaggagtcaccaaacaagcagcaggagagagcccaaagc
cagagtggtgtggacttgcaggaagatgtgcttgtaagagagagacccagatccttggag
gatctccatcagaaaaaagtaggccgggctaagagagaaagtaggagaatgagagaacta
gagcaagctatatttagcttagaattgctgaaagttcgttctcttggtggtatttctcct
tcagaggatcgcagatggtctacagaattggtgcctgaaggccttcaatctccacgaggt
acacctgatagtgagagctctcaaggaagcttggaacttctgagctatgaggaaagccaa
aagagcaaactagagtctgtcatttcagatgaaggagacttgcagtttccatcacctaag
atatccagcagtccaaaatttgattcacgggacaatgccctcagtgcctcaaatgagact
agcaatgcagagcatttgaaggatggaactatgaaggaaaaggtggtctgcagttctgag
tctattacctgtaaaccacagctgaaagactccttcatttcaaatagtctacctactttt
ttttatatcccccaacaagacccactgaaaacaaattcccaactagacacaagtatccaa
agaaacaaactattggaaaatgaagacacagcgggggaagctcttactttggatatcaac
agggaaactagaaggtatcactgctcaggaaaagatcagattgttccttctttgaataca
gagtcttctaatcctgtgcttaagaagttagaaaagctaaacactgagaaggaagaaagg
caaaaacagttgcagcaacagaatgaaaaagagatgatggaacagattcgccagcaaaca
gatattttagagaaggagcgcaaagccttcaagacaattgaaaagccaagaattggagag
tgtttggtggcaccatcttcctatcagtcaaagcaaagagtagagaggccatcttctctc
ctcagcttaaatacctcaaataagggagaacttaatgtactggggtccctatcattaaaa
gatgcagctcttgcccaaaaagacagttcatctgctcacttacccccaaaggaccgacct
gtcaccgtgttctttgaaagaaaaggaagtccatgccaatctagtactgtcaaggaatta
tccaagacagacagaatgggcacccagctgaatgtagcctgtaaactctcaaataatcgc
atttcaaaaagagaacactttaggccaactcaatcttacagccacaattctgatgacctt
tccagagagggaaatgctaggcccattttcttcactccaaaggacaatatgagtattccc
cttgtcagcaaagaagccgtaaacagtgaaaatcctcaactccataaagaagatgaacca
gcatggaaacctgtgaagttagctgggccaggccaaagagagacatcacagcgattttcg
tcagttgatgaacaagcaaaacttcataagactatgtctcaaggagagattaccaagttg
gcagtgagacagaaggcttcagattcagatataagacctcagagagctaagatgagattc
tgggccaaagggaaacaaggggagaagaagactaccagagtgaaacctactacccagtca
gaggtttcgccactctttgcaggcacagatgtgattccagctcatcagtttccagatgaa
ttagctgcatatcacccaacacctcctttgagcccggaactgcccggcagttgccggaag
gaattcaaagagaacaaagaaccttctccaaaggctaagcgcaagcgaagtgtgaagatt
agcaacgtggctttggattctatgcattggcaaaatgactctgtccagatcatagcaagt
gtcagtgatttaaaaagcatggatgaatttcttctgaaaaaggtgaatgacctagataat
gaagacagcaagaaggatacactagtggatgttgtatttaaaaaagccctgaaggaattt
cggcagaatatcttcagcttttattcatctgcattggcgatggatgatgggaaaagcata
cggtataaagacctctatgcactatttgaacagattctggaaaagacgatgaggcttgag
cagcgtgattcactgggtgaatctccagtgagagtttgggtcaacacttttaaagtgttt
ttagatgaatatatgaatgaattcaagacttcagattgcacagccacaaaggtgccaaaa
acagaaagaaagaaaagaaggaaaaaggaaactgatttggtggaagaacacaatggtcac
atctttaaagccacccaatatagcatccctacatactgtgaatactgttcttctttgata
tggataatggaccgagcctctgtttgcaaattatgcaagtatgcttgccataagaagtgc
tgtctgaaaaccacagccaagtgctctaaaaagtatgatccagagctgtcatctcgacaa
tttggggttgaactgtcccgtttgaccagtgaagaccgaactgttcctttagtagtggaa
aagctcataaactacattgaaatgcatggactgtatacagaaggtatttatcgaaagtct
ggttcgactaataaaatcaaggagcttcggcagggtctagatacagatgctgagagtgta
aatctagatgactataacatacacgtcattgcaagtgtattcaaacaatggcttcgagat
ttgcccaatcctctcatgacctttgaactctatgaggaatttcttcgagctatgggcctt
caggagaggaaggagacaatccgtggtgtatactctgtgattgatcaactctcccgaact
catctcaatacactggaacgcctcatctttcatctagtcaggattgctctgcaggaagac
actaatcgaatgtctgctaatgctttggccattgtgtttgcgccctgcattctccgctgc
cctgacaccactgacccgctacaaagtgtacaggacatcagtaagactaccacttgtgtg
gaactgatcgttgtggaacaaatgaataaatacaaggctcgtctcaaagatatcagtagc
ttggaatttgctgagaataaggcaaagaccaggttgtcactgattcgtagatcaatggga
aaggggcgtattcgtcgaggaaactatccaggtccatcgtctcctgttgtagttcggttg
ccttctgtgtctgatgtctcagaggagaccttgactagtgaggcagccatggagactgac
atcacagaacagcagcaagcagctatgcagcaggaggagagagtactgactgagcagatt
gagaacctacagaaggagaaggaggagctaacatttgagatgcttgtactggaaccccgt
gcctctgacgatgaaacccttgagtctgaggcctccattgggactgctgatagctcagaa
aatttgaatatggagtctgaatgtgctatctctgagaaatcagaaagaagcttagcgctt
agctccctgaagacagctggcaagtctgaaccttccagcaagttgcgaaagcaagttaaa
aagcagcaagactctttagatgtcgtggactcttcggtctcctctttatgtctgtctaac
acggcatcatctcatgggaccagaaaactatttcagatttattccaaatctccattctac
cgagctgcctcaggtaatgaggccctgggaatggaaggaccattgggccagaccaaattc
ctggaagacaagcctcagttcatcagcagaggaaccttcaacccggaaaagggcaaacaa
aaattaaagactgtgaaaaactcacctcagaaaaccaaagagaccccagaggggacagtc
atgtctggccgcagaaaaactgtggacccagactgcacctccaaccaacagctagcactc
tttggaaataatgaatttatggtctga

DBGET integrated database retrieval system