KEGG   Pan paniscus (bonobo): 100982135Help
Entry
100982135         CDS       T02283                                 

Gene name
PIK3C2B
Definition
(RefSeq) phosphatidylinositol-4-phosphate 3-kinase catalytic subunit type 2 beta
  KO
K00923  phosphatidylinositol-4-phosphate 3-kinase [EC:2.7.1.154]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps00562  Inositol phosphate metabolism
pps01100  Metabolic pathways
pps04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:pps00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100982135 (PIK3C2B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    100982135 (PIK3C2B)
Enzymes [BR:pps01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.154  phosphatidylinositol-4-phosphate 3-kinase
     100982135 (PIK3C2B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI3_PI4_kinase PI3Ka PI3K_C2 PI3K_rbd PX C2 DUF4135 HEAT_2
Motif
Other DBs
NCBI-GeneID: 100982135
NCBI-ProteinID: XP_008974824
UniProt: A0A2R9AIX4
Position
1
AA seq 1634 aa AA seqDB search
MSSTQGNGEHWKSLESVGISRKELAMAEALQMEYDALSRLRHDKEENRAKQNADPSLISW
DEPGVDFYSKPAGRRTDLKLLRGLSGSDPTLNYNSLSPQEGPPNHSTSQGPQPGSDPWPK
GSLSGHYLYIFDGSDGGVSSSPGPGDIEGSCKKLSPPPLPPRASIWDTPPLPPRKGSPSS
SKISQPSDINTFSLVEQLPGKLLEHRILEEEEVPGGGGQGRLLGSVDYEGINDAITRLNL
KSTYDAEMLRDATRGWKEGRGPLDFSKDTSGKPVARSKTMPPQVPPRTYASRYGNRKNAT
PGKNRRISAAPVGSRPHTVANGHELFEVSEERDEEVAAFCHMLDILRSGSDIQDYFLTGY
VWSAVTPSPEHLGDEVNLKVTVLCDRLQEALTFTCNCSSTVDLLIYQTLCYTHDDLRNVD
VGDFVLKPCGLEEFLQNKHALGSHEYIQYCRKFDIDIRLQLMEQKVVRSDLARTVNDDQS
PSTLNYLVHLQERPVKQTISRQALSLLFDTYHNEVDAFLLADGDFPLKADRVVQSVKAIC
NALAAVETPEITNALNQLPPCPSRMQPKIQKDPSVLAVRENREKVVEALTAAILDLVELY
CNTFNADFQTAVPGSRKHDLVQEACHFARSLAFTVYATHRIPIIWATSYEDFYLSCSLSH
GGKELCSPLQTRRAHFSKYLFHLIVWDQQICFPVQVNRLPRETLLCATLYALPIPPPGSS
SEANKQRRVPEALGWVTTPLFNFRQVLTCGRKLLGLWPATQENPSARWSAPNFHQPDSVI
LQIDFPTSAFDIKFTSPPGDKFSPRYEFGSLREEDQRKLKDIMQKESLYWLTDADKKRLW
EKRYYCHSEVSSLPLVLASAPSWEWACLPDIYALLKQWTHMNHQDALGLLHATFPDQEVR
RMAVQWIGSLSDAELLDYLPQLVQALKYECYLDSPLVRFLLKRAVSDLRVTHYFFWLLKD
GLKDSQFSIRYQYLLAALLCCCGKGLREEFNRQCWLVNALAKLAQQVREAAPSARQGILR
TGLEEVKQFFALNGSCRLPLSPSLLVKGIVPRDCSYFNSNAVPLKLSFQNVDPLGENIRV
IFKCGDDLRQDMLTLQMIRIMSKIWVQEGLDMRMVIFRCFSTGRGRGMVEMIPNAETLRK
IQVEHGVTGSFKDRPLADWLQKHNPGEDEYEKAVENFIYSCAGCCVATYVLGICDRHNDN
IMLKTTGHMFHIDFGRFLGHAQMFGNIKRDRAPFVFTSDMAYVINGGDKPSSRFHDFVDL
CCQAYNLIRKHTHLFLNLLGLMLSCGIPELSDLEDLKYVYDALRPQDTEANATTYFTRLI
ESSLGSVATKLNFFIHNLAQMKFTGSDDRLTLSFASRTHTLKSSGRISDVFLCRHEKIFH
PNKGYIYVVKVMRENTHEATYIQRTFEEFQELHNKLRLLFPSSHLPSFPSRFVIGRSRGE
AVAERRREELNGYIWHLIHAPPEVAECDLVYTFFHPLPRDEKAMGTSPAPKSSDGTWARP
VGKVGGEVKLSISYKNNKLFIMVMHIRGLQLLQDGNDPDPYVKIYLLPDPQKTTKRKTKV
ARKTCNPTYNEMLVYDGIPKGDLQQRELQLSVLSEQGFWENVLLGEVNIRLRELDLAQEK
TGWFALGSRSHGTL
NT seq 4905 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcgactcagggcaatggggaacactggaagtccctggagtcagtgggcatcagc
cgcaaagagctagcgatggccgaagccctgcagatggagtatgatgccctgtcccggctc
cggcatgacaaggaggagaacagagccaagcagaacgcagacccctctctcatcagttgg
gatgagcctggggtagacttttacagcaagccagcaggaaggcggaccgacctcaagctg
ttacgcggtctctctggctctgatcctaccctcaactacaactcactctccccacaggaa
gggccgcccaaccactctacctcccaagggccacagcctggctcagatccctggcccaaa
ggctccctgtctggacactatctctacatttttgatggttcagatgggggagtctcttcg
tccccaggaccaggggacatagagggctcttgcaagaaactatccccacctcctctgcct
ccccgagcttctatctgggatacccctcccctgcctcccagaaaggggtccccctcatcc
tccaagatctcccagcccagtgacatcaacactttctctttggtcgaacaattgccgggc
aaactgctagagcatcggatcctagaagaggaagaggtgccgggaggtgggggtcagggg
cgcctactggggtctgtggactatgagggtatcaatgatgcaattactaggctcaacttg
aaatcgacctatgatgcggagatgttgcgggatgccaccaggggctggaaggagggccga
gggccgctggacttcagcaaagacacctctggaaaacccgtggccaggagcaagactatg
ccccctcaggtgcccccccgcacctatgcctcccgctatggcaaccgaaagaatgcgacg
cctggcaagaaccgccggatttctgcagccccggtgggctcccggccccacactgttgcc
aatggccatgagttgtttgaggtctcagaagagagagatgaggaggttgctgcattttgc
cacatgctggatatccttcgatctggctctgacatccaagactacttcctcactggctat
gtctggagtgctgtcacccctagcccagagcacctcggggatgaggtcaacctgaaggtg
actgtgttgtgtgacaggcttcaagaggcactcactttcacctgcaactgttcctccact
gtagacttgcttatctaccagaccctgtgctacacccatgatgacctgaggaatgtggac
gtgggtgactttgtgctaaagccctgcgggctggaggagttcctgcagaacaagcatgcc
ttgggcagtcatgagtacatccaatactgccgcaagtttgacattgacattcggctacag
ctgatggagcagaaggttgtgcgcagtgacctggcccggacggtgaacgatgaccagagc
ccctccaccttgaactacctcgtccatctccaagagaggcctgtcaagcagaccatcagc
aggcaggccctgagtcttctgttcgacacttaccacaatgaggtggatgccttcctgctg
gctgatggagacttcccactgaaggctgacagggtggtccagtccgtcaaggccatctgc
aacgccctggccgccgtggaaacccctgagatcaccaatgctctcaaccagctgcccccc
tgcccctcccgcatgcagcctaaaattcagaaggatcccagtgtcttggctgtgagggaa
aaccgagagaaggtcgtggaagccctgaccgctgccatcttggacctagtggagctgtac
tgcaacacattcaacgcagacttccagacggcagtgcccgggagccgcaagcatgacctg
gtccaggaggcctgccatttcgccaggtccctggccttcactgtctatgccacccaccgc
atccccatcatctgggctaccagctatgaagatttctacctctcctgctccctcagccac
ggcggcaaggagctgtgcagccccctgcagacccgaagagctcacttctccaagtacctc
ttccacctcatcgtctgggaccagcagatctgcttcccagtgcaggtgaaccggctgcct
cgggagacattgctgtgtgccactctctatgctctgcccatccccccaccggggagctcc
tcagaggccaataagcagcggcgggtgcctgaagccctgggctgggtcactaccccactc
ttcaacttcaggcaggtcctgacctgtggccggaagcttctgggtttgtggccagcaaca
caggaaaatcccagcgcccgttggagtgcacctaatttccaccagccagacagtgtcatc
ctgcagattgacttccccacctcggcctttgacatcaagttcaccagcccccctggagac
aagttcagccctcgctatgagtttggcagcctccgggaagaagaccagcgcaagcttaaa
gacatcatgcagaaagagtccttgtactggctcactgatgctgacaagaagcgcctgtgg
gagaagcgatattactgccactcggaggtgagctcgctccccctggtgctcgccagcgcc
cccagctgggagtgggcttgcctgcctgacatctatgctctcctgaagcagtggacccac
atgaaccaccaggatgccctggggctcctgcatgccaccttcccggaccaggaggtgcgt
cgtatggctgtgcagtggattggctcactctcagatgctgagctgctagactacctgccc
cagctggtacaggccctgaagtatgaatgctacctggacagcccgttggtgcgcttcctc
ctgaaacgagctgtgtctgacttgagagtgactcactacttcttctggttactgaaggac
ggcctcaaggactctcagttcagcatccgctaccagtatctgctggcagccttactgtgc
tgctgtggcaaggggctgagagaagagtttaaccgccagtgctggcttgtcaatgccctg
gccaaactggcccagcaggtccgggaggcagccccatctgcaaggcagggaatcctccgc
acaggcctggaggaggtgaagcagttctttgccctcaatggctcgtgccgcttgccactc
agccccagtctgctggttaagggaatcgtgcccagggactgttcctacttcaactccaat
gctgtccccctcaaactctccttccaaaatgtggatcccctgggtgagaacatccgtgtc
atcttcaagtgtggggacgaccttcgccaggacatgctaacgctgcagatgattcgcatc
atgagcaagatctgggtccaggaggggctggacatgcgcatggtcatcttccgctgcttc
tccaccggccggggcagagggatggtggagatgatccctaatgccgagaccctgcgtaag
atccaggtggagcatggggtgaccggctcgttcaaggaccggcccctggcagactggctg
cagaaacacaaccctggggaggacgagtatgagaaggctgtggagaactttatctactcc
tgcgctggctgctgcgtggccacgtacgtcttgggcatctgtgaccgacataacgacaac
atcatgctgaagaccactggtcacatgttccacattgattttggccgcttcctgggccat
gcccagatgtttggcaacatcaagcgggaccgtgccccctttgtcttcacctcggacatg
gcgtatgtcatcaacgggggtgacaagccttccagccgcttccatgattttgttgacctt
tgctgccaagcctacaacctcattcgcaagcacacccacctcttcctcaaccttctgggc
ctgatgttgtcctgtgggatccctgaactctcagacctggaggacctcaagtatgtgtac
gatgccctgaggcctcaggatacagaggccaatgccactacctacttcactaggttgatt
gagtccagcctgggcagtgtagccacaaagctcaattttttcatccataatctggctcag
atgaagttcacgggctcagatgaccggctgaccctctcctttgcctcccgaacacacact
ctcaagagctctggccgaatcagtgatgttttcctctgccgccatgagaagatcttccac
cccaacaaaggctatatatatgtggtaaaggtgatgcgagagaacactcacgaggccacc
tatatccagcggacctttgaggagttccaggaattacacaataagttgcggctgctcttc
ccttcttcccacttgcccagcttccctagtcgcttcgtgatcggccgctcccggggagag
gcggtggccgagcggcggagggaggagctaaacggttacatctggcacttgatccacgca
ccccccgaggtggccgagtgtgatttggtgtacaccttcttccacccactgccccgggat
gagaaggctatgggcaccagcccagctcctaagtcctcagatggcacatgggcccggccc
gtcggaaaggtgggaggggaggtgaagctgtccatctcctacaaaaacaataaactcttc
atcatggtgatgcatattcggggcttgcaactgctccaggatggaaatgaccctgacccc
tatgtgaaaatttacctccttcctgaccctcagaaaaccactaagaggaaaaccaaagtg
gcccggaaaacctgcaatcctacctacaatgagatgttggtatatgatgggatccccaag
ggagacctgcagcagcgggagctccagctgagcgtgctgagtgagcagggattctgggag
aacgtcctgctcggtgaggtgaacatccgcctgcgagagctggacctggctcaggagaag
accggctggttcgccctgggatctcgaagtcatggcaccttgtga

DBGET integrated database retrieval system