KEGG   Pan paniscus (bonobo): 100982206
Entry
100982206         CDS       T02283                                 

Gene name
RORC
Definition
(RefSeq) RAR related orphan receptor C
  KO
K08534  RAR-related orphan receptor gamma
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04659  Th17 cell differentiation
pps04710  Circadian rhythm
pps05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:pps00001]
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    100982206 (RORC)
  09159 Environmental adaptation
   04710 Circadian rhythm
    100982206 (RORC)
 09160 Human Diseases
  09163 Immune disease
   05321 Inflammatory bowel disease
    100982206 (RORC)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pps03000]
    100982206 (RORC)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:pps03310]
    100982206 (RORC)
Transcription factors [BR:pps03000]
 Eukaryotic type
  Zinc finger
   Cys4 thyroid hormone receptor-like
    100982206 (RORC)
Nuclear receptors [BR:pps03310]
 1. Thyroid hormone like
  1F. RAR-related orphan receptor
   100982206 (RORC)
SSDB
Motif
Pfam: zf-C4 Hormone_recep DUF4647 PX
Other DBs
NCBI-GeneID: 100982206
NCBI-ProteinID: XP_003817274
UniProt: A0A2R8ZTF3
Position
1
AA seq 497 aa
MRTQIEVIPCKICGDKSSGIHYGVITCEGCKGFFRRSQRCNAAYSCTRQQNCPIDRTSRN
RCQHCRLQKCLALGMSRDAVKFGRMSKKQRDSLHAEVQKQLQQRQQQQQEPVVKTPPAGA
QGADTLTYTLGLPDGQLPLGSSPDLPEASACPPGLLKASGSGASYSNNLAKAGLNGASCH
LEDSPERGKAEGRESFYSTGSQLTPDRCGLRFEEHRHPGLGELGQGPDSYGSPSFRSTPE
APYASLTEIEHLVQSVCKSYRETCQLRLEDLLRQRSNIFSREEVTGYQRKSMWEMWERCA
HHLTEAIQYVVEFAKRLSGFMELCQNDQIVLLKAGAMEVVLVRMCRAYNADNRTVFFEGK
YGGMELFRALGCSELISSIFDFSHSLSALHFSEDEIALYTALVLINAHRPGLQEKRKVEQ
LQYNLELAFHHHLCKTHRQSILAKLPPKGKLRNLCSQHVERLQIFQHLHPIVVQAAFPPL
YKELFSTETESPVGLSK
NT seq 1494 nt   +upstreamnt  +downstreamnt
atgagaacacaaattgaagtgatcccttgcaaaatctgtggggacaagtcgtctgggatc
cactacggggttatcacctgtgaggggtgcaagggcttcttccgccggagccagcgctgt
aacgcggcctactcctgcacccgtcagcagaactgccccatcgaccgcaccagccgaaac
cgatgccagcactgccgcctgcagaaatgcctggcgctgggcatgtcccgagatgctgtc
aagtttggccgcatgtccaagaagcagagggacagcctgcatgcagaagtgcagaaacag
ctgcagcagcggcaacagcagcaacaggaaccagtggtcaagacccctccagcaggggcc
caaggagcagataccctcacctacaccttggggctcccagacgggcagctgcccctgggc
tcctcgcctgacctgcctgaggcttctgcctgtccccctggcctcctgaaagcctcaggc
tctggggcctcatattccaacaacttggccaaggcagggctcaatggggcctcatgccac
cttgaagacagccctgagcggggcaaggctgagggcagagagagcttctatagcacaggc
agccagctgacccctgaccgatgtggacttcgttttgaggaacacaggcatcccgggctt
ggggaactgggacagggcccagacagctacggcagccccagtttccgcagcacaccggag
gcaccctatgcctccctgacagagatagagcacctggtgcagagcgtctgcaagtcctac
agggagacatgccagctgcggctggaggacctgctgcggcagcgctccaacatcttctcc
cgggaggaagtgactggctaccagaggaagtccatgtgggagatgtgggaacggtgtgcc
caccacctcaccgaggccattcagtacgtggtggagttcgccaagaggctctcaggcttt
atggagctctgccagaatgaccagattgtgcttctcaaagcaggagcaatggaagtggtg
ctggttaggatgtgccgggcctacaatgctgacaaccgcacggtcttttttgaaggcaaa
tacggtggcatggagctgttccgagccttgggctgcagcgagctcatcagctccatcttt
gacttctcccactccctaagtgccttgcacttttccgaggatgagattgccctctacaca
gcccttgttctcatcaatgcccatcggccagggctccaagagaaaaggaaagtagaacag
ctgcagtacaatctggagctggcctttcatcatcatctctgcaagactcatcgccaaagc
atcctggcaaagctgccacccaaggggaagcttcggaacctgtgtagccagcatgtggaa
aggctgcagatcttccagcacctccaccccatcgtggtccaagccgctttccctccactc
tacaaggagctcttcagcactgaaaccgagtcacctgtggggctgtccaagtga

DBGET integrated database retrieval system