KEGG   Pan paniscus (bonobo): 100982303Help
Entry
100982303         CDS       T02283                                 

Gene name
PAH
Definition
(RefSeq) phenylalanine hydroxylase
  KO
K00500  phenylalanine-4-hydroxylase [EC:1.14.16.1]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps00360  Phenylalanine metabolism
pps00400  Phenylalanine, tyrosine and tryptophan biosynthesis
pps00790  Folate biosynthesis
pps01100  Metabolic pathways
pps01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pps00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    100982303 (PAH)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    100982303 (PAH)
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    100982303 (PAH)
Enzymes [BR:pps01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.16  With reduced pteridine as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.16.1  phenylalanine 4-monooxygenase
     100982303 (PAH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Biopterin_H ACT ACT_4
Motif
Other DBs
NCBI-GeneID: 100982303
NCBI-ProteinID: XP_003832619
UniProt: A0A2R8ZCI5
Position
12
AA seq 452 aa AA seqDB search
MSTAVLENPGLGRKLSDFGQETSYIEDNCNQNGAISLIFSLKEEVGALAKVLRLFEENDI
NLTHIESRPSRLKKDEYEFFTHLDKRSLPALTNIIKILRHDIGATVHELSRDKKKDTVPW
FPRTIQELDRFANQILSYGAELDADHPGFKDPVYRARRKQFADIAYNYRHGQPIPRVEYM
EEEKKTWGTVFKTLKSLYKTHACYEYNHIFPLLEKYCGFHEDNIPQLEDVSQFLQTCTGF
RLRPVAGLLSSRDFLGGLAFRVFHCTQYIRHGSKPMYTPEPDICHELLGHVPLFSDRSFA
QFSQEIGLASLGAPDEYIEKLATIYWFTVEFGLCKQGDSIKAYGAGLLSSFGELQYCLSE
KPKLLPLELEKTAIQNYTVTEFQPLYYVAESFNDAKEKVRNFAATIPRPFSVRYDPYTQR
IEVLDNTQQLKILADSINSEIGILCSALQKIK
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgtccactgcggtcctggaaaacccaggcttgggcaggaaactctctgactttggacag
gaaacaagctatattgaagacaactgcaatcaaaatggtgccatatcactgatcttctca
ctcaaagaagaagttggtgcattggccaaagtattgcgcttatttgaggagaatgatata
aacctgacccacattgaatctagaccttctcgtttaaagaaagatgagtatgaatttttc
acccatttggataaacgtagcctgcctgctctgacaaacatcatcaagatcttgaggcat
gacattggtgccactgtccatgagctttcacgagataagaagaaagacacagtgccctgg
ttcccaagaaccattcaagagctggacagatttgccaatcagattctcagctatggagcg
gaactggatgctgaccaccctggttttaaagatcctgtgtaccgtgcaagacggaagcag
tttgctgacattgcctacaactaccgccatgggcagcccatccctcgagtggaatacatg
gaggaagaaaagaaaacatggggcacagtgttcaagactctgaagtccttgtataaaacc
catgcttgctatgagtacaatcacatttttccacttcttgaaaagtactgtggcttccat
gaagataacattccccagctggaagatgtttctcaattcctgcagacttgcactggtttc
cgcctccgacctgtggctggcctgctttcctctcgggatttcttgggtggcctggccttc
cgagtcttccactgcacacagtacatcagacatggatccaagcccatgtatacccccgaa
cctgacatctgccatgagctgttgggacatgtgcccttgttttcagatcgcagctttgcc
cagttttcccaggaaattggccttgcctctctgggtgcacctgatgaatacattgaaaag
ctcgccacaatttactggtttactgtggagtttgggctctgcaaacaaggagactccata
aaggcatatggtgctgggctcctgtcatcctttggtgaattacagtactgcttatcagag
aagccaaagcttctccccctggagctggagaagacagccatccaaaattacactgtcacg
gagttccagcccctgtattacgtggcggagagttttaatgatgccaaggagaaagtaagg
aactttgctgccacaatacctcggcccttctcagttcgctacgacccatacacccaaagg
attgaggtcttggacaatacccagcagcttaagattttggctgattccattaacagtgaa
attggaatcctgtgcagtgccctccagaaaataaagtaa

DBGET integrated database retrieval system