KEGG   Pan paniscus (bonobo): 100982469Help
Entry
100982469         CDS       T02283                                 

Gene name
SUV39H2
Definition
(RefSeq) suppressor of variegation 3-9 homolog 2
  KO
K11419  histone-lysine N-methyltransferase SUV39H [EC:2.1.1.43]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:pps00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    100982469 (SUV39H2)
Enzymes [BR:pps01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     100982469 (SUV39H2)
Chromosome and associated proteins [BR:pps03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     100982469 (SUV39H2)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    100982469 (SUV39H2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET Pre-SET Chromo
Motif
Other DBs
NCBI-GeneID: 100982469
NCBI-ProteinID: XP_003806810
Position
10
AA seq 410 aa AA seqDB search
MAAVGAEPRGAWCVPCLVSLDTLQELCRKEKLTCKSIGITKRNLNNYEVEYLCDYKVVKD
MEYYLVKWKGWPDSTNTWEPLQNLKCPLLLQQFSNDKHNYLSQVKKGKAITPKDNNKTLK
PAIAEYIVKKAKQRIALQRWQDELNRRKNHKGMIFVENTVDLEGPPSDFYYINEYKPAPG
ISLVNEATFGCSCTDCFFQKCCPAEAGVLLAYNKNQQIKIPPGTPIYECNSRCQCGPDCP
NRIVQKGTQYSLCIFRTSNGRGWGVKTLVKIKRMSFVMEYVGEVITSEEAERRGQFYDNK
GITYLFDLDYESDEFTVDAARYGNVSHFVNHSCDPNLQVFNVFIDNLDTRLPRIALFSTR
TINAGEELTFDYQMKGSGDISSDSIDHSPAKKRVRTVCKCGAVTCRGYLN
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggtcggggccgagccgcgaggagcttggtgtgtgccttgcctagtttcactt
gatactcttcaggaattatgtagaaaagaaaagctcacatgtaaatcgattggaatcacc
aaaaggaatctaaacaattatgaggtggaatacttgtgtgactacaaggtagtaaaggat
atggaatattatcttgtaaaatggaaaggatggccagattctacaaatacttgggaacct
ttgcaaaatctgaagtgcccgttactgcttcagcaattctctaatgacaagcataattat
ttatctcaggtaaagaaaggcaaagcaataactccaaaagacaataacaaaactttgaaa
cctgccattgctgagtacattgtgaagaaggctaaacaaaggatagctctgcagagatgg
caagatgaactcaacagaagaaagaatcataaaggaatgatatttgttgaaaatactgtt
gatttagagggcccaccttcagacttctattacattaacgaatacaaaccagctcctgga
atcagcttagtcaatgaagctacctttggttgttcatgcacagattgcttctttcaaaaa
tgttgtcctgctgaagctggagttcttttggcttataataaaaaccaacaaattaaaatc
ccacctggtactcccatctatgaatgcaactcaaggtgtcaatgtggtcctgattgtccc
aataggattgtacaaaaaggcacacagtattcgctttgcatctttcgaactagcaatgga
cgtggctggggtgtaaagacccttgtgaagattaaaagaatgagttttgtcatggaatat
gttggagaggtaatcacgagtgaagaagctgaaagacggggacagttctatgacaacaag
ggaatcacgtatctctttgatctggactatgaatctgatgaattcacagtggatgcggct
cgatacggcaatgtgtctcattttgtgaatcacagctgtgacccaaatcttcaggtgttc
aatgttttcatcgataacctcgatactcgtcttccccgaatagcattgttttctacaaga
accataaatgctggagaagagctgacttttgattatcaaatgaaaggttctggagatata
tcttcagattctattgaccacagcccagccaaaaagagggtcagaacagtatgtaaatgt
ggagctgtgacttgcagaggttacctcaactga

DBGET integrated database retrieval system