KEGG   Pan paniscus (bonobo): 100982660
Entry
100982660         CDS       T02283                                 

Gene name
LTBR
Definition
(RefSeq) lymphotoxin beta receptor
  KO
K03159  lymphotoxin beta receptor TNFR superfamily member 3
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04060  Cytokine-cytokine receptor interaction
pps04061  Viral protein interaction with cytokine and cytokine receptor
pps04064  NF-kappa B signaling pathway
pps04066  HIF-1 signaling pathway
pps04672  Intestinal immune network for IgA production
pps05166  Human T-cell leukemia virus 1 infection
pps05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    100982660 (LTBR)
   04066 HIF-1 signaling pathway
    100982660 (LTBR)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100982660 (LTBR)
   04061 Viral protein interaction with cytokine and cytokine receptor
    100982660 (LTBR)
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    100982660 (LTBR)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100982660 (LTBR)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100982660 (LTBR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:pps04050]
    100982660 (LTBR)
Cytokine receptors [BR:pps04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   100982660 (LTBR)
SSDB
Motif
Pfam: TNFR_c6 TMEM252
Other DBs
NCBI-GeneID: 100982660
NCBI-ProteinID: XP_003820367
UniProt: A0A2R9BG90
Position
12
AA seq 435 aa
MLLPWATSAPGLAWGPLVLGLFGLLAASQPQAVPPYASENQTCRDQEKEYYEPQHRICCS
RCPPGTYVSAKCSRIRDTVCATCAENSYNEHWNYLTICQLCRPCDPVMGLEEIAPCTSKR
KTQCRCQPGMFCAAWALECTHCELLSDCPPGTEAELKDEVGKGNNHCVPCKAGHFQNTSS
PSARCQPHTRCEDQGLVEAAPGTAQSDTTCRNPSEPLPPEMSGTMLMLAILLPLAFFLLL
ATVFACIWKSHPSLCRKLGSLLKRRPQGEGPNPVAGSWEPPKAHPYFPDLVQPLLPISGD
VSPVSTGLPAAPVLEAGVPQQQSPLDLTREPQLEPGEQSQVAHGTNGIHVTGGSMTITGN
IYIYNGPVLGGPPGPGDLPATPEPPYPIPEEGDPGPPGLSTPHQEDGKAWHLAETEHCGA
TPSNRGPRNQFITHD
NT seq 1308 nt   +upstreamnt  +downstreamnt
atgctcctgccttgggccacctctgcccccggcctggcctgggggcctctggtgctgggc
ctcttcgggctcctggcagcatcccagccccaggcggtgcctccatatgcgtcggagaac
cagacctgcagggaccaggaaaaggaatactatgagccccagcaccgcatctgctgctcc
cgctgcccgccaggcacctatgtctcagctaaatgtagccgcatccgggacacagtttgt
gccacttgtgccgaaaattcctacaacgagcactggaactacctgaccatctgccagctg
tgccgcccctgtgacccagtgatgggcctggaggagattgccccctgcacaagcaaacgg
aagacccagtgccgctgccagccgggaatgttctgtgctgcctgggccctcgagtgtaca
cactgcgagctactttctgactgcccgcctggcactgaagccgagctcaaagatgaagtt
gggaagggtaacaaccactgcgtcccctgcaaggcagggcacttccagaatacctcctcc
cccagcgcccgctgccagccccacaccaggtgtgaggaccaaggtttggtggaggcagct
ccaggcactgcccagtctgacacaacctgcagaaatccatcagagccactgcccccagag
atgtcaggaaccatgctgatgctggccattctgctgccgctggccttctttctgctcctt
gccaccgtcttcgcctgcatctggaagagccacccttctctctgcaggaaactgggatcg
ctgctcaagaggcgtccgcagggagagggacccaatcctgtagctggaagctgggagcct
ccgaaggcccatccatacttccctgacctggtacagccactgctacccatttctggagat
gtttccccagtatccactgggctccccgcagccccagttttggaggcaggggtgccgcaa
cagcagagtcctctggacctgaccagggagccgcagttggaacccggggagcagagccag
gtggcccacggtaccaatggcattcatgtcaccggcgggtctatgactatcactggcaac
atctacatctacaatggaccagtactggggggaccaccgggtcctggagacctcccagct
acccccgaacctccataccccattcccgaagagggggaccctggccctcccgggctctct
acaccccaccaggaagatggcaaggcttggcacctagcggagacagagcactgtggtgcc
acaccctctaacaggggcccaaggaaccaatttatcacccatgactga

DBGET integrated database retrieval system