KEGG   Pan paniscus (bonobo): 100983185
Entry
100983185         CDS       T02283                                 

Gene name
EP300
Definition
(RefSeq) E1A binding protein p300
  KO
K04498  E1A/CREB-binding protein [EC:2.3.1.48]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04024  cAMP signaling pathway
pps04066  HIF-1 signaling pathway
pps04068  FoxO signaling pathway
pps04110  Cell cycle
pps04310  Wnt signaling pathway
pps04330  Notch signaling pathway
pps04350  TGF-beta signaling pathway
pps04520  Adherens junction
pps04630  JAK-STAT signaling pathway
pps04720  Long-term potentiation
pps04916  Melanogenesis
pps04919  Thyroid hormone signaling pathway
pps04922  Glucagon signaling pathway
pps04935  Growth hormone synthesis, secretion and action
pps05016  Huntington disease
pps05152  Tuberculosis
pps05161  Hepatitis B
pps05164  Influenza A
pps05165  Human papillomavirus infection
pps05166  Human T-cell leukemia virus 1 infection
pps05167  Kaposi sarcoma-associated herpesvirus infection
pps05200  Pathways in cancer
pps05203  Viral carcinogenesis
pps05206  MicroRNAs in cancer
pps05211  Renal cell carcinoma
pps05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100983185 (EP300)
   04330 Notch signaling pathway
    100983185 (EP300)
   04350 TGF-beta signaling pathway
    100983185 (EP300)
   04630 JAK-STAT signaling pathway
    100983185 (EP300)
   04066 HIF-1 signaling pathway
    100983185 (EP300)
   04068 FoxO signaling pathway
    100983185 (EP300)
   04024 cAMP signaling pathway
    100983185 (EP300)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100983185 (EP300)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    100983185 (EP300)
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    100983185 (EP300)
   04935 Growth hormone synthesis, secretion and action
    100983185 (EP300)
   04919 Thyroid hormone signaling pathway
    100983185 (EP300)
   04916 Melanogenesis
    100983185 (EP300)
  09156 Nervous system
   04720 Long-term potentiation
    100983185 (EP300)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100983185 (EP300)
   05206 MicroRNAs in cancer
    100983185 (EP300)
   05203 Viral carcinogenesis
    100983185 (EP300)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    100983185 (EP300)
   05215 Prostate cancer
    100983185 (EP300)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100983185 (EP300)
   05161 Hepatitis B
    100983185 (EP300)
   05164 Influenza A
    100983185 (EP300)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100983185 (EP300)
   05165 Human papillomavirus infection
    100983185 (EP300)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100983185 (EP300)
  09164 Neurodegenerative disease
   05016 Huntington disease
    100983185 (EP300)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pps03000]
    100983185 (EP300)
   03036 Chromosome and associated proteins [BR:pps03036]
    100983185 (EP300)
   03029 Mitochondrial biogenesis [BR:pps03029]
    100983185 (EP300)
Enzymes [BR:pps01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100983185 (EP300)
Transcription factors [BR:pps03000]
 Eukaryotic type
  Other transcription factors
   Pocket domain CBP
    100983185 (EP300)
Chromosome and associated proteins [BR:pps03036]
 Eukaryotic type
  Histone modification proteins
   HATs (histone acetyltransferases)
    100983185 (EP300)
Mitochondrial biogenesis [BR:pps03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    100983185 (EP300)
SSDB
Motif
Pfam: HAT_KAT11 KIX Creb_binding zf-TAZ DUF902 Bromodomain ZZ KIX_2 Npa1
Other DBs
NCBI-GeneID: 100983185
NCBI-ProteinID: XP_003814668
UniProt: A0A2R9ATU0
Position
22
AA seq 2411 aa
MAENVVEPGPPSAKRPKLSSPALSASASDGTDFGSLFDLEHDLPDELINSTELGLTNGGD
INQLQTSLGMVQDAASKHKQLSELLRSGSSPNLNMGVGGPGQVMASQAQQSSPGLGLINS
MVKSPMTQAGLTSPNMGMGTSGPNQGPTQSTGMMNSPVNQPAMGMNTGMNAGMNPGMLAA
GNGQGIMPNQVMNGSIGAGRGRQNMQYPNPGMGSAGNLLTEPLQQGSPQMGGQTGLRGPQ
PLKMGMMNNPNPYGSPYTQNPGQQIGASGLGLQIQTKTVLSNNLSPFAMDKKAVPGGGMP
NMGQQPAPQVQQPGLVTPVAQGMGSGAHTADPEKRKLIQQQLVLLLHAHKCQRREQANGE
VRQCNLPHCRTMKNVLNHMTHCQSGKSCQVAHCASSRQIISHWKNCTRHDCPVCLPLKNA
GDKRNQQPILTGAPVGLGNPSSLGVGQQSAPNLSTVSQIDPSSIERAYAALGLPYQVNQM
PTQPQVQAKNQQNQQPGQSPQGMRPMSNMSASPMGVNGGVGVQTPSLLSDSMLHSAINSQ
NPMMSENASVPSLGPMPTAAQPSTTGIRKQWHEDITQDLRNHLVHKLVQAIFPTPDPAAL
KDRRMENLVAYARKVEGDMYESANNRAEYYHLLAEKIYKIQKELEEKRRTRLQKQNMLPN
AAGMVPVSMNPGPNMGQPQPGMTSNGPLPDPSMIRGSVPNQMMPRITPQSGLNQFGQMSM
AQPPIVPRQTPPLQHHGQLAQPGALNPPMGYGPRMQQPSNQGQFLPQTQFPSQGMNVTNI
PLAPSSGQAPVSQAQMSSSSCPVNSPIMPPGSQGSHIHCPQLPQPALHQNSPSPVPSRTP
TPHHTPPSIGAQQPPATTIPAPVPTPPAMPPGPQSQALHPPPRQTPTPPTTQLPQQVQPS
LPAAPSADQPQQQPRSQQSTAASVPTPTAPLLPPQPATPLSQPAVSIEGQVSNPPSTSST
EVNSQAIPEKQPSQEVKMEAKMEVDQPEPADTQPEDISESKVEDCKMESTETEERSTELK
TEIKEEEDQPSTSATQSSPAPGQSKKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVD
PQLLGIPDYFDIVKSPMDLSTIKRKLDTGQYQEPWQYVDDIWLMFNNAWLYNRKTSRVYK
YCSKLSEVFEQEIDPVMQSLGYCCGRKLEFSPQTLCCYGKQLCTIPRDATYYSYQNRYHF
CEKCFNEIQGESVSLGDDPSQPQTTINKEQFSKRKNDTLDPELFVECTECGRKMHQICVL
HHEIIWPAGFVCDGCLKKSARTRKENKFSAKRLPSTRLGTFLENRVNDFLRRQNHPESGE
VTVRVVHASDKTVEVKPGMKARFVDSGEMAESFPYRTKALFAFEEIDGVDLCFFGMHVQE
YGSDCPPPNQRRVYISYLDSVHFFRPKCLRTAVYHEILIGYLEYVKKLGYTTGHIWACPP
SEGDDYIFHCHPPDQKIPKPKRLQEWYKKMLDKAVSERIVHDYKDIFKQATEDRLTSAKE
LPYFEGDFWPNVLEESIKELEQEEEERKREENTSNESTDVTKGDSKNAKKKNNKKTSKNK
SSLSRGNKKKPGMPNVSNDLSQKLYATMEKHKEVFFVIRLIAGPAANSLPPIVDPDPLIP
CDLMDGRDAFLTLARDKHLEFSSLRRAQWSTMCMLVELHTQSQDRFVYTCNECKHHVETR
WHCTVCEDYDLCITCYNTKNHDHKMEKLGLGLDDESNNQQAAATQSPGDSRRLSIQRCIQ
SLVHACQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPICKQLIALCCYHAKHCQENK
CPVPFCLNIKQKLRQQQLQHRLQQAQMLRRRMASMQRTGVVGQQQGLPSPTPATPTTPTG
QQPTTPQTPQPTSQPQPTPPNSMPPYLPRTQAAGPVSQGKAAGQVTPPTPPQTAQPPLPG
PPPAAVEMAMQIQRAAETQRQMAHVQIFQRPIQHQMPPMTPMAPMGMNPPPMTRGPSGHL
EPGMGPTGMQQQPPWSQGGLPQPQQLQSGMPRPAMMSVAQHGQPLNMAPQPGLGQVGVSP
LKPGTVSQQALQNLLRTLRSPSSPLQQQQVLSILHANPQLLAAFIKQRAAKYANSNPQPI
PGQPGMPQGQPGLQPPTMPGQQGVHSNPAMQNMNPMQAGVQRAGLPQQQPQQQLQPPMGG
MSPQAQQMNMNHNTMPSQFRDILRRQQMMQQQQQQGAGPGIGPGMANHNQFQQPQGVGYP
PQQQQRMQHHMQQGNMGQIGQLPQALGAEAGASLQAYQQRLLQQQMGSPVQPNPMSPQQH
MLPNQAQSPHLQGQQIPNSLSNQVRSPQPVPSPRPQSQPPHSSPSPRMQPQPSPHHVSPQ
TSSPHPGLVAAQANPMEQGHFASPDQNSMLSQLASNPGMANLHGASATDLGLSTDNSDLN
SNLSQSTLDIH
NT seq 7236 nt   +upstreamnt  +downstreamnt
atggccgagaatgtggtggaaccggggccgccttcagccaagcggcctaaactctcatct
ccggccctctcggcgtccgccagcgatggcacagattttggctctctatttgacttggag
cacgacttaccagatgaattaatcaactctacagaattgggactaaccaatggtggtgat
attaatcagcttcagacaagtcttggcatggtacaagatgcagcttctaaacataaacag
ctgtcagaattgctgcgatctggtagttcccctaacctcaatatgggagttggtggccca
ggtcaagtcatggccagccaggcccaacagagcagtcctggattaggtttgataaatagc
atggtcaaaagcccaatgacacaggcaggcttgacttctcccaacatggggatgggcact
agtggaccaaatcagggtcctacgcagtcaacaggtatgatgaacagtccagtaaatcag
cctgccatgggaatgaacacagggatgaatgcgggcatgaatcctggaatgttggctgca
ggcaatggacaagggataatgcctaatcaagtcatgaacggttcaattggagcaggccga
gggcgacagaatatgcagtacccaaacccaggcatgggaagtgctggcaacttactgact
gagcctcttcagcagggctctccccagatgggaggacaaacaggattgagaggcccccag
cctcttaagatgggaatgatgaacaaccccaatccttatggttcaccatatactcagaat
cctggacagcagattggagccagtggccttggtctccagattcagacaaaaactgtacta
tcaaataacttatctccatttgctatggacaaaaaggcagttcctggtggaggaatgccc
aacatgggtcaacagccagccccgcaggtccagcagccaggcctggtgactccagttgcc
caagggatgggttctggagcacatacagctgatccagagaagcgcaagctcatccagcag
cagcttgttctccttttgcatgctcacaagtgccagcgccgcgaacaggccaatggggaa
gtgaggcagtgcaaccttccccactgtcgcacaatgaagaatgtcctaaaccacatgaca
cactgccagtcaggcaagtcttgccaagtggcacactgtgcatcttctcgacaaatcatt
tcacactggaagaattgtacaagacatgattgtcctgtgtgtctccccctcaaaaatgct
ggtgataagagaaatcaacagccaattttgactggagcacccgttggacttggaaatcct
agctctctaggggtgggtcaacagtctgcccccaacctaagcactgttagtcagattgat
cccagctctatagaaagagcctatgcagctcttggactaccctatcaagtaaatcagatg
ccgacacaaccccaggtgcaagcaaagaaccagcagaatcagcagcctgggcagtctccc
caaggcatgcggcccatgagcaacatgagtgctagtcctatgggagtaaatggaggtgta
ggagttcaaacgccgagtcttctttctgactcaatgttgcattcagccataaattctcaa
aacccaatgatgagtgaaaatgccagtgtgccctccctgggtcctatgccaacagcagct
caaccatccactactggaattcggaaacagtggcacgaagatattactcaggatcttcga
aatcatcttgttcacaaactcgtccaagccatatttcctacgccggatcctgctgcttta
aaagacagacggatggaaaacctagttgcatatgctcggaaagttgaaggggacatgtat
gaatctgcaaacaatcgagcggaatactaccaccttctagctgagaaaatctataagatc
cagaaagaactagaagaaaaacgaaggaccagactacagaagcagaacatgctaccaaat
gctgcaggcatggttccagtttccatgaatccagggcctaacatgggacagccgcaacca
ggaatgacttctaatggccctctacctgacccaagtatgatccgtggcagtgtgccaaac
cagatgatgcctcggataactccacaatctggtttgaatcaatttggccagatgagcatg
gcccagccccctattgtaccccggcaaacccctcctctgcagcaccatggacagttggct
caacctggagctctcaacccgcctatgggctatgggcctcgtatgcaacagccttccaac
cagggccagttccttcctcagactcagttcccatcacagggaatgaatgtaacaaatatc
cctttggctccgtccagcggtcaagctccagtgtctcaagcacaaatgtctagttcttcc
tgcccggtgaactctcctataatgcctccagggtctcaggggagccacattcactgtccc
cagcttcctcaaccagctctgcatcagaattcaccctcacctgtacctagtcgtaccccc
acccctcaccatactcccccaagcataggggctcagcagccaccagcaacaacaattcca
gcccctgttcctacacctcctgccatgccacctgggccacagtcccaggctctacatccc
cctccaaggcagacacctacaccaccaacaacacaacttccccaacaagtgcagccttca
cttcctgctgcaccttctgctgaccagccccagcagcagcctcgctcacagcagagcaca
gcagcatctgttcctaccccaacagcaccgctgcttcctccgcagcctgcaactccactt
tcccagccagctgtaagcattgaaggacaggtatcaaaccctccatctactagtagcaca
gaagtgaattctcaggccattcctgagaagcagccttcccaggaagtgaagatggaggcc
aaaatggaagtggatcaaccagaaccagcagatactcagccggaggatatttcagagtct
aaagtggaagactgtaaaatggaatctaccgaaacagaagagagaagcactgagttaaaa
actgaaataaaagaggaggaagaccagccaagtacttcagctacccagtcatctccggct
ccaggacagtcaaagaaaaagattttcaaaccagaagaactacgacaggcactgatgcca
acattggaggcactttaccgtcaggatccagaatcccttccctttcgtcaacctgtggac
cctcagcttttaggaatccctgattactttgatattgtgaagagccccatggatctttct
accattaagaggaagttagacactggacagtatcaggagccctggcaatatgtcgatgat
atttggcttatgttcaataatgcctggttatataaccggaaaacatcacgggtatacaaa
tactgctccaagctctctgaggtctttgaacaagaaattgacccagtgatgcaaagcctt
ggatactgttgtggcagaaagttggagttctctccacagacactgtgttgctacggcaaa
cagttgtgcacaatacctcgtgatgccacttattacagttaccagaacaggtatcatttc
tgtgagaagtgtttcaatgagatccaaggggagagcgtttctttgggggatgacccttcc
cagcctcaaactacaataaataaagaacaattttccaagagaaaaaatgacacactggat
cctgaactgtttgttgaatgtacagagtgcggaagaaagatgcatcagatctgtgtcctt
caccatgagatcatctggcctgctggattcgtctgtgacggctgtttaaagaaaagtgca
cgaactaggaaagaaaataagttttctgctaaaaggttgccatctaccagacttggcacc
tttctagagaatcgtgtgaatgactttctgaggcgacagaatcaccctgagtcaggagag
gtcactgttagagtagttcatgcttctgacaaaaccgtggaagtaaaaccaggcatgaaa
gcaaggtttgtggacagtggagagatggcagaatcctttccataccgaaccaaagccctc
tttgcctttgaagaaattgatggtgttgacctgtgcttctttggcatgcatgttcaagag
tatggctctgactgccctccacccaaccagaggagagtatacatatcttacctcgatagt
gttcatttcttccgtcctaaatgcttgaggactgcagtctatcatgaaatcctaattgga
tatttagaatatgtcaagaaattaggttacacaacagggcatatttgggcatgtccacca
agtgagggagatgattatatcttccattgccatcctcctgaccagaagatacctaagccc
aagcgactgcaggaatggtacaaaaaaatgcttgacaaggctgtatcagagcgtattgtc
catgactacaaggatatttttaaacaagctactgaagatagattaacaagtgcaaaggaa
ttgccttacttcgagggtgatttctggcccaatgttctggaagaaagcattaaggaactg
gaacaggaggaagaagagagaaaacgagaggaaaacaccagcaatgaaagcacagatgtg
accaagggagacagcaaaaatgctaaaaagaagaataataagaaaaccagcaaaaataag
agcagcctgagtaggggcaacaagaagaaacccgggatgcccaatgtatctaacgacctc
tcacagaaactatatgccaccatggagaagcataaagaggtcttctttgtgatccgcctc
attgctggccctgctgccaactccctgcctcccattgttgatcctgaccctctcatcccc
tgcgatctgatggatggtcgggatgcatttctcacgctggcaagggacaagcacctggag
ttctcttcactccgaagagcccagtggtccaccatgtgcatgctggtggagctgcacacg
cagagccaggaccgctttgtctacacctgcaatgaatgcaagcaccatgtggagacacgc
tggcactgtactgtctgtgaggattatgacttgtgtatcacctgctataacactaaaaac
catgaccacaaaatggagaaactaggccttggcttagatgatgagagcaacaaccagcag
gctgcagccacccagagcccaggcgattctcgccgcctgagtatccagcgctgcatccag
tctctggtccatgcttgccagtgtcggaatgccaattgctcactgccatcctgccagaag
atgaagcgggttgtgcagcataccaagggttgcaaacggaaaaccaatggcgggtgcccc
atctgcaagcagctcattgccctctgctgctaccatgccaagcactgccaggagaacaaa
tgcccggtgccgttctgcctaaacatcaagcagaagctccggcagcaacagctgcagcac
cgactacagcaggcccaaatgcttcgcaggaggatggccagcatgcagcggactggtgtg
gttgggcagcaacagggcctcccttcgcccactcctgccactccaacaacaccaactggc
caacagccaaccaccccgcagacgccccagcccacttctcagcctcagcctacccctccc
aatagcatgccaccttacttgcccaggactcaagctgctggccctgtgtcccagggtaag
gcagcaggccaggtgactcctccaacccctcctcagactgctcagccaccccttccaggg
cccccacctgcagcagtggaaatggcaatgcagattcagagagcagcggagacgcagcgc
cagatggcccacgtgcaaatttttcaaaggccaatccaacaccagatgcccccgatgact
cccatggcccccatgggtatgaacccacctcccatgaccagaggtcccagtgggcatttg
gagccagggatgggaccgacagggatgcagcagcagccaccctggagccaaggaggattg
cctcagccccagcaactacagtctgggatgccaaggccagccatgatgtcagtggcccag
catggtcaacctttgaacatggctccacaaccaggattgggccaggtaggtgtcagccca
ctcaaaccaggcactgtgtctcaacaagccttacaaaaccttttgcggactctcaggtct
cccagctctcccctgcagcagcaacaggtgcttagtatccttcacgccaacccccagctg
ttggctgcattcatcaagcagcgggctgccaagtatgccaactctaatccacaacccatc
cctgggcagcctggcatgccccaggggcagccagggctgcagccacctaccatgccaggt
cagcagggggtccactccaatccagccatgcagaacatgaatccaatgcaggcgggcgtt
cagagggctggcctgccccagcagcaaccacagcagcaactccagccacccatgggaggg
atgagcccccaggctcagcagatgaacatgaaccacaacaccatgccttcacaattccga
gacatcttgagacgacagcaaatgatgcaacagcagcagcaacagggagcagggccagga
ataggccctggaatggccaaccataaccagttccagcaaccccaaggagttggctaccca
ccacagcagcagcagcggatgcagcatcacatgcaacaaggaaatatgggacagataggc
cagcttccccaggccttgggagcagaggcaggtgccagtctacaggcctatcagcagcga
ctccttcagcaacagatggggtcccctgttcagcccaaccccatgagcccccagcagcat
atgctcccaaatcaggcccagtccccacacctacaaggccagcagatccctaattctctc
tccaatcaagtgcgctctccccagcctgtcccttctccacggccacagtcccagcccccg
cactccagcccttccccaaggatgcagcctcagccttctccacaccacgtttccccacag
acaagttccccacatcctggactggtagctgcccaggccaaccccatggaacaagggcat
tttgccagcccggaccagaattcaatgctttctcagcttgctagcaatccaggcatggca
aacctccatggtgcaagcgccacggacctgggactcagcaccgataactcagacttgaat
tcaaacctctcacagagtacactagacatacactag

KEGG   Pan paniscus (bonobo): 100984888
Entry
100984888         CDS       T02283                                 

Gene name
CREBBP
Definition
(RefSeq) CREB binding protein
  KO
K04498  E1A/CREB-binding protein [EC:2.3.1.48]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04024  cAMP signaling pathway
pps04066  HIF-1 signaling pathway
pps04068  FoxO signaling pathway
pps04110  Cell cycle
pps04310  Wnt signaling pathway
pps04330  Notch signaling pathway
pps04350  TGF-beta signaling pathway
pps04520  Adherens junction
pps04630  JAK-STAT signaling pathway
pps04720  Long-term potentiation
pps04916  Melanogenesis
pps04919  Thyroid hormone signaling pathway
pps04922  Glucagon signaling pathway
pps04935  Growth hormone synthesis, secretion and action
pps05016  Huntington disease
pps05152  Tuberculosis
pps05161  Hepatitis B
pps05164  Influenza A
pps05165  Human papillomavirus infection
pps05166  Human T-cell leukemia virus 1 infection
pps05167  Kaposi sarcoma-associated herpesvirus infection
pps05200  Pathways in cancer
pps05203  Viral carcinogenesis
pps05206  MicroRNAs in cancer
pps05211  Renal cell carcinoma
pps05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100984888 (CREBBP)
   04330 Notch signaling pathway
    100984888 (CREBBP)
   04350 TGF-beta signaling pathway
    100984888 (CREBBP)
   04630 JAK-STAT signaling pathway
    100984888 (CREBBP)
   04066 HIF-1 signaling pathway
    100984888 (CREBBP)
   04068 FoxO signaling pathway
    100984888 (CREBBP)
   04024 cAMP signaling pathway
    100984888 (CREBBP)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100984888 (CREBBP)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    100984888 (CREBBP)
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    100984888 (CREBBP)
   04935 Growth hormone synthesis, secretion and action
    100984888 (CREBBP)
   04919 Thyroid hormone signaling pathway
    100984888 (CREBBP)
   04916 Melanogenesis
    100984888 (CREBBP)
  09156 Nervous system
   04720 Long-term potentiation
    100984888 (CREBBP)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100984888 (CREBBP)
   05206 MicroRNAs in cancer
    100984888 (CREBBP)
   05203 Viral carcinogenesis
    100984888 (CREBBP)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    100984888 (CREBBP)
   05215 Prostate cancer
    100984888 (CREBBP)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100984888 (CREBBP)
   05161 Hepatitis B
    100984888 (CREBBP)
   05164 Influenza A
    100984888 (CREBBP)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100984888 (CREBBP)
   05165 Human papillomavirus infection
    100984888 (CREBBP)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100984888 (CREBBP)
  09164 Neurodegenerative disease
   05016 Huntington disease
    100984888 (CREBBP)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pps03000]
    100984888 (CREBBP)
   03036 Chromosome and associated proteins [BR:pps03036]
    100984888 (CREBBP)
   03029 Mitochondrial biogenesis [BR:pps03029]
    100984888 (CREBBP)
Enzymes [BR:pps01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100984888 (CREBBP)
Transcription factors [BR:pps03000]
 Eukaryotic type
  Other transcription factors
   Pocket domain CBP
    100984888 (CREBBP)
Chromosome and associated proteins [BR:pps03036]
 Eukaryotic type
  Histone modification proteins
   HATs (histone acetyltransferases)
    100984888 (CREBBP)
Mitochondrial biogenesis [BR:pps03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    100984888 (CREBBP)
SSDB
Motif
Pfam: HAT_KAT11 KIX Creb_binding zf-TAZ DUF902 Bromodomain ZZ KIX_2 Npa1
Other DBs
NCBI-GeneID: 100984888
NCBI-ProteinID: XP_008966263
Position
16
AA seq 2339 aa
MASLSAMGKSPLSQGDSSAPSLPKQAASTSGPTPPASQALNPQAQKQVGLATSSPATSQT
GPGICMNANFNQTHPGLLNSNSGHSLINQASQGQAQVMNGSLGAAGRGRGAGMPYPTPAM
QGASSSVLAETLTQVSPQMTGHAGLNTAQAGGMAKMGITGNTSPFGQPFSQAGGQPMGAT
GVNPQLASKQSMVNSLPTFPTDIKNTSVTNVPNMSQMQTSVGIVPTQAIATGPTADPEKR
KLIQQQLVLLLHAHKCQRREQANGEVRACSLPHCRTMKNVLNHMTHCQAGKACQVAHCAS
SRQIISHWKNCTRHDCPVCLPLKNASDKRNQQTILGSPASGIQNTIGSVGTGQQNATSLS
NPNPIDPSSMQRAYAALGLPYMNQPQTQLQPQVPGQQPAQPQTHQQMRTLNPLGNNPMNI
PAGGITTDQQPPNLISESALPTSLGATNPLMNDGSNSGNIGTLSTIPTAAPPSSTGVRKG
WHEHVTQDLRSHLVHKLVQAIFPTPDPAALKDRRMENLVAYAKKVEGDMYESANSRDEYY
HLLAEKIYKIQKELEEKRRSRLHKQGILGNQPALPAPGAQPPVIPQAQPVRPPNGPLSLP
VNRMQVSQGMNSFNPMSLGNVQLPQAPMGPRAASPMNHSVQMNSMGSVPGMAISPSRMPQ
PPNMMGAHTNNMMAQAPAQSQFLPQNQFPSSSGAMSVGMGQPPAQTGVSQVPGAALPNPL
NMLGPQASQLPCPPVTQSPLHPTPPPASTAAGMPSLQHTTPPGMTPPQPAAPTQPSTPVS
SSGQTPTPTPGSVPSATQTQSTPTVQAAAQAQVTPQPQTPVQPPSVATPQSSQQQPTPVH
AQPPGTPLSQAAASIDNRVPTPSSVASAETNSQQPGPDVPVLEMKTETQAEDTEPDPGES
KGEPRSEMMEEDLQGASQVKEETDIAEQKSEPMEVDEKKPEVKVEVKEEEESSSNGTASQ
STSPSQPRKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPM
DLSTIKRKLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKFCSKLAEVFEQEIDPVM
QSLGYCCGRKYEFSPQTLCCYGKQLCTIPRDAAYYSYQNSSPKYGLLADRYHFCEKCFTE
IQGENVTLGDDPSQPQTTISKDQFEKKKNDTLDPEPFVDCKECGRKMHQICVLHYDIIWP
SGFVCDNCLKKTGRPRKENKFSAKRLQTTRLGNHLEDRVNKFLRRQNHPEAGEVFVRVVA
SSDKTVEVKPGMKSRFVDSGEMSESFPYRTKALFAFEEIDGVDVCFFGMHVQEYGSDCPP
PNTRRVYISYLDSIHFFRPRCLRTAVYHEILIGYLEYVKKLGYVTGHIWACPPSEGDDYI
FHCHPPDQKIPKPKRLQEWYKKMLDKAFAERIIHDYKDIFKQATEDRLTSAKELPYFEGD
FWPNVLEESIKELEQEEEERKKEESTAASETTEGSQGDSKNAKKKNNKKTNKNKSSISRA
NKKKPSMPNVSNDLSQKLYATMEKHKEVFFVIHLHAGPVINTLPPIVDPDPLLSCDLMDG
RDAFLTLARDKHWEFSSLRRSKWSTLCMLVELHTQGQDRFVYTCNECKHHVETRWHCTVC
EDYDLCINCYNTKSHAHKMVKWGLGLDDEGSSQGEPQSKSPQESRRLSIQRCIQSLVHAC
QCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPVCKQLIALCCYHAKHCQENKCPVPFC
LNIKHKLRQQQIQHRLQQAQLMRRRMATMNTRNVPQQSLPSPTSAPPGTPTQQPSTPQTP
QPPAQPQPSPVSMSPAGFPSVARTQPPTTVSTGKPTSQVPAPPPPAQPPPAAVEAARQIE
REAQQQQHLYRVNINNSMPPGRTGMGTPGSQMAPVSLNVPRPNQVSGPVMPSMPPGQWQQ
APLPQQQPMPGLPRPVISMQAQVAVAGPRMPSVQPPRSISPSALQDLLRTLKSPSSPQQQ
QQVLNILKSNPQLMAAFIKQRTAKYVANQPGMQPQPGLQSQPGMQPQPGMHQQPSLQNLN
AMQAGVPRPGVPPQQQAMGGLNPQGQALNIMNPGHNPNMASMNPQYREMLRRQLLQQQQQ
QQQQQQQQQQQQQGSAGMAGGMAGHGQFQQPQGPGGYPPAMQQQQRMQQHLPLQGSSMGQ
MAAQMGQLGQMGQPGLGADSTPNIQQALQQRILQQQQMKQQIGSPGQPNPMSPQQHMLSG
QPQASHLPGQQIATSLSNQVRSPAPVQSPRPQSQPPHSSPSPRIQPQPSPHHVSPQTGSP
HPGLAVTMASSIDQGHLGNPEQSAMLPQLNTPSRSALSSELSLVGDTTGDTLEKFVEGL
NT seq 7020 nt   +upstreamnt  +downstreamnt
atggccagcctcagtgccatgggcaagagccctctgagccagggagattcttcagccccc
agcctgcctaaacaggcagccagcacctctgggcccaccccccctgcctcccaagcactg
aatccgcaagcacaaaagcaagtggggctggcgactagcagccctgccacgtcacagact
ggacctggtatctgcatgaatgctaactttaaccagacccacccaggcctcctcaatagt
aactctggccatagcttaattaatcaggcttcacaagggcaggcgcaagtcatgaatgga
tctcttggggctgctggcagaggaaggggagctggaatgccgtaccctactccagccatg
cagggcgcctcgagcagcgtgctggctgagaccctaacgcaggtttccccgcaaatgact
ggtcacgcgggactgaacaccgcacaggcaggaggcatggccaagatgggaataactggg
aacacaagtccatttggacagccctttagtcaagctggagggcagccaatgggagccact
ggagtgaacccccagttagccagcaaacagagcatggtcaacagtttgcccaccttccct
acagacatcaagaatacttcagtcaccaacgtgccaaatatgtctcagatgcaaacatca
gtgggaattgtacccacacaagcaattgcaacaggccccactgcagatcctgaaaaacgc
aaactgatacagcagcagctggttctactgcttcatgctcataagtgtcagagacgagag
caagcaaacggagaggttcgggcctgctcgctcccgcattgtcgaaccatgaaaaacgtt
ttgaatcacatgacgcattgtcaggctgggaaagcctgccaagttgcccattgtgcatct
tcacgacaaatcatctctcattggaagaactgcacacgacatgactgtcctgtttgcctc
cctttgaaaaatgccagtgacaagcgaaaccaacaaaccatcctggggtctccagctagt
ggaattcaaaacacaattggttctgttggcacagggcaacagaatgccacttctttaagt
aacccaaatcccatagaccccagctccatgcagcgagcctatgctgctctcggactcccc
tacatgaaccagccccagacgcagctgcagcctcaggttcctggccagcaaccagcacag
cctcaaacccaccagcagatgaggactctcaaccccctgggaaataatccaatgaacatt
ccagcaggaggaataacaacagatcagcagcccccaaacttgatttcagaatcagctctt
ccgacttccctgggggccacaaacccactgatgaacgatggctccaactctggtaacatt
ggaaccctcagcactataccaacagcagctcctccttctagcaccggtgtaaggaaaggc
tggcacgaacatgtcactcaggacctgcggagccatctagtgcataaactcgtccaagcc
atcttcccaacacctgatcccgcagctctaaaggatcgccgcatggaaaacctggtagcc
tatgctaagaaagtggaaggggacatgtacgagtctgccaacagcagggatgaatattat
cacttattagcagagaaaatctacaagatacaaaaagaactagaagaaaaacggaggtcg
cgtttacataaacaaggcatcttggggaaccagccagccttaccagccccgggggctcag
ccccctgtgattccacaggcacaacctgtgagacctccaaatggacccctgtccctgcca
gtgaatcgcatgcaagtttctcaagggatgaattcatttaaccccatgtccttggggaat
gtccagttgccacaagcacccatgggacctcgtgcagcctccccaatgaaccactctgtc
cagatgaacagcatgggctcagtgccagggatggccatttctccttcccgaatgcctcag
cctccgaacatgatgggtgcacacaccaacaacatgatggcccaggcgcccgctcagagc
cagtttctgccacagaaccagttcccgtcatccagcggggcgatgagtgtgggcatgggg
cagccgccagcccaaacaggcgtgtcacaggtgcctggtgctgctcttcctaaccctctc
aacatgctggggcctcaggccagccagctaccttgccctccagtgacacagtcaccactg
cacccaacaccgcctcctgcttccacggctgctggcatgccatctctccagcacacgaca
ccacctgggatgactcctccccagccagcagctcccactcagccatcaactcctgtgtcg
tcttccgggcagactcccaccccgactcctggctcagtgcccagtgctacccaaacccag
agcacccctacagtccaggcagcagcccaggcccaggtgaccccgcagcctcaaacccca
gttcagcccccgtctgtggctacccctcagtcatcgcagcaacagccgacgcctgtgcac
gcccagcctcctggcacaccgctttcccaggcagcagccagcattgataacagagtccct
accccctcctcggtggccagcgcagaaaccaattcccagcagccaggacctgacgtacct
gtgctggaaatgaagacggagacccaagcagaggacactgagcccgatcctggtgaatcc
aaaggggagcccaggtctgagatgatggaggaggatttgcaaggagcttcccaagttaaa
gaagaaacagacatagcagagcagaaatcagaaccaatggaagtggatgaaaagaaacct
gaagtgaaagtagaagttaaagaggaagaagagagtagcagtaacggcacagcctctcag
tcaacatctccttcacagccacgcaaaaaaatctttaaaccagaggagttacgccaggcc
ctcatgccaaccctagaagcactgtatcgacaggacccagagtcattacctttccggcag
cctgtagatccccagctcctcggaattccagactattttgacatcgtaaagaatcccatg
gacctctccaccatcaagcggaagctggacacagggcaataccaagagccctggcagtac
gtggacgacgtctggctcatgttcaacaatgcctggctctataatcgcaagacatcccga
gtctataagttttgcagtaagcttgcagaggtctttgagcaggaaattgaccctgtcatg
cagtcccttggatattgctgtggacgcaagtatgagttttccccacagactttgtgctgc
tatgggaagcagctgtgtaccattcctcgcgatgctgcctactacagctatcagaatagt
tcacccaagtatggccttcttgctgacaggtatcatttctgtgagaagtgtttcacagag
atccagggcgagaatgtgaccctgggtgacgacccttcacagccccagacgacaatttca
aaggatcagtttgaaaagaagaaaaatgacaccttagaccccgaacctttcgttgattgc
aaggagtgtggccggaagatgcatcagatttgcgttctgcactatgacatcatttggcct
tcgggttttgtgtgcgacaactgcttgaagaaaactggcagacctcgaaaagaaaacaaa
ttcagtgctaagaggctgcagaccacaagactgggaaaccacttggaagaccgagtgaac
aaatttttgcggcgccagaatcaccctgaagccggggaggtttttgtccgagtggtggcc
agctcagacaagacggtggaggtcaagcccgggatgaagtcacggtttgtggattctggg
gaaatgtctgaatctttcccatatcgaaccaaagctctgtttgcttttgaggaaattgac
ggcgtggatgtctgcttttttggaatgcacgtccaagaatacggctctgattgcccccct
ccaaacacgaggcgtgtgtacatttcttatctggatagtattcatttcttccggccacgt
tgcctccgcacagccgtttaccatgagatccttattggatatttagagtatgtgaagaaa
ttggggtatgtgacagggcacatctgggcctgtcctccaagtgaaggagatgattacatc
ttccattgccacccacctgatcaaaaaatacccaagccaaaacgactgcaggagtggtac
aaaaagatgctggacaaggcgtttgcagagcggatcatccatgactacaaggatattttc
aaacaagcaactgaagacaggctcaccagtgccaaggaactgccctattttgaaggtgat
ttctggcccaatgtgttagaagagagcattaaggaactagaacaagaagaagaggagagg
aaaaaggaagagagcactgcagccagtgaaaccactgagggcagtcagggcgacagcaag
aatgccaagaagaagaacaacaagaaaaccaacaagaacaaaagcagcatcagccgcgcc
aacaagaagaagcccagcatgcccaacgtgtccaatgacctgtcccagaagctgtatgcc
accatggagaagcacaaggaggtcttcttcgtgatccacctgcacgctgggcctgtcatc
aacaccctgccccccatcgtcgaccccgaccccctgctcagctgtgacctcatggatggg
cgcgacgccttcctcaccctcgccagagacaagcactgggagttctcctccttgcgccgc
tccaagtggtccacgctctgcatgctggtggagctgcacacccagggccaggaccgcttt
gtctacacctgcaacgagtgcaagcaccacgtggagacgcgctggcactgcactgtgtgc
gaggactacgacctctgcatcaactgctataacacgaagagccatgcccataagatggtg
aagtgggggctgggcctggatgacgagggcagcagccagggcgagccacagtcaaagagc
ccccaggagtcacgccggctgagcatccagcgctgcatccagtcgctggtgcacgcgtgc
cagtgccgcaacgccaactgctcgctgccatcctgccagaagatgaagcgggtggtgcag
cacaccaagggctgcaaacgcaagaccaacgggggctgcccggtgtgcaagcagctcatc
gccctctgctgctaccatgccaagcactgccaagaaaacaaatgccccgtgcccttctgc
ctcaacatcaaacacaagctccgccagcagcagatccagcaccgcctgcagcaggcccag
ctcatgcgccggcggatggccaccatgaacacccgcaacgtgcctcagcagagtctgcct
tctcctacctcagcaccgcccgggacccccacacagcagcccagcacaccccagacgccg
cagccccctgcccagccccaaccctcacccgtgagcatgtcaccagctggcttccccagc
gtggcccggactcagccccccaccacggtgtccacagggaagcctaccagccaggtgccg
gcccccccacccccggcccagccccctcctgcagcggtggaagcggctcggcagatcgag
cgtgaggcccagcagcagcagcacctgtaccgggtgaacatcaacaacagcatgccccca
ggacgcacgggcatggggaccccggggagccagatggcccccgtgagcctgaatgtaccc
cgacccaaccaggtgagcgggcccgtcatgcccagcatgcctcctgggcagtggcagcag
gcgccccttccccagcagcagcccatgccaggcttgcccaggcctgtgatatccatgcag
gcccaggtggccgtggctgggccccggatgcccagtgtgcagccacccaggagcatctca
cccagcgctctgcaagacctgctgcggaccctgaagtcgcccagctcccctcagcagcaa
cagcaggtgctgaacattctcaaatcaaacccgcagctaatggcagctttcatcaaacag
cgcacagccaagtacgtggccaatcagcccggcatgcagccccagcctggcctccagtcc
cagcccggcatgcaaccccagcctggcatgcaccagcagcccagcctgcagaacctgaac
gccatgcaggctggcgtgccgcggcccggtgtgcctccacagcagcaggcgatgggaggc
ctgaacccccagggccaggccttgaacatcatgaacccaggacacaaccccaacatggcg
agtatgaatccacagtaccgagaaatgttacggaggcagctgctgcagcagcagcagcaa
cagcagcagcaacaacagcagcaacagcagcagcagcaagggagtgccggcatggctggg
ggcatggcggggcacggccagttccagcagcctcaaggacccggaggctacccaccggcc
atgcagcagcagcagcgcatgcagcagcatctccccctccagggcagctccatgggccag
atggcggctcagatgggacagcttggccagatggggcagccggggctgggggcagacagc
acccccaacatccagcaagccctgcagcagcggattctgcagcaacagcagatgaagcag
cagattgggtccccaggccagccgaaccccatgagcccccagcaacacatgctctcagga
cagccacaggcctcgcatctccctggccagcagatcgccacatcccttagtaaccaggtg
cggtctccagcccctgtccagtctccacggccccagtcccagcctccacattccagcccg
tcaccacggatacagccccagccttcgccacaccacgtctcaccccagactggttccccc
caccccggactcgcagtcaccatggccagctccatagatcagggacacttggggaacccc
gaacagagtgcaatgctcccccagctgaacacccccagcaggagtgcactgtccagcgaa
ctgtccctggtcggggacaccacgggggacacgctagagaagtttgtggagggcttgtag

DBGET integrated database retrieval system