KEGG   Pan paniscus (bonobo): 100983212
Entry
100983212         CDS       T02283                                 

Gene name
TNFRSF1A
Definition
(RefSeq) TNF receptor superfamily member 1A
  KO
K03158  tumor necrosis factor receptor superfamily member 1A
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04010  MAPK signaling pathway
pps04060  Cytokine-cytokine receptor interaction
pps04061  Viral protein interaction with cytokine and cytokine receptor
pps04064  NF-kappa B signaling pathway
pps04071  Sphingolipid signaling pathway
pps04150  mTOR signaling pathway
pps04210  Apoptosis
pps04215  Apoptosis - multiple species
pps04217  Necroptosis
pps04380  Osteoclast differentiation
pps04668  TNF signaling pathway
pps04920  Adipocytokine signaling pathway
pps04931  Insulin resistance
pps04932  Non-alcoholic fatty liver disease
pps05010  Alzheimer disease
pps05014  Amyotrophic lateral sclerosis
pps05022  Pathways of neurodegeneration - multiple diseases
pps05132  Salmonella infection
pps05142  Chagas disease
pps05145  Toxoplasmosis
pps05152  Tuberculosis
pps05160  Hepatitis C
pps05163  Human cytomegalovirus infection
pps05164  Influenza A
pps05165  Human papillomavirus infection
pps05166  Human T-cell leukemia virus 1 infection
pps05167  Kaposi sarcoma-associated herpesvirus infection
pps05168  Herpes simplex virus 1 infection
pps05170  Human immunodeficiency virus 1 infection
pps05171  Coronavirus disease - COVID-19
pps05417  Lipid and atherosclerosis
pps05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100983212 (TNFRSF1A)
   04064 NF-kappa B signaling pathway
    100983212 (TNFRSF1A)
   04668 TNF signaling pathway
    100983212 (TNFRSF1A)
   04071 Sphingolipid signaling pathway
    100983212 (TNFRSF1A)
   04150 mTOR signaling pathway
    100983212 (TNFRSF1A)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100983212 (TNFRSF1A)
   04061 Viral protein interaction with cytokine and cytokine receptor
    100983212 (TNFRSF1A)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100983212 (TNFRSF1A)
   04215 Apoptosis - multiple species
    100983212 (TNFRSF1A)
   04217 Necroptosis
    100983212 (TNFRSF1A)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    100983212 (TNFRSF1A)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100983212 (TNFRSF1A)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100983212 (TNFRSF1A)
   05170 Human immunodeficiency virus 1 infection
    100983212 (TNFRSF1A)
   05160 Hepatitis C
    100983212 (TNFRSF1A)
   05171 Coronavirus disease - COVID-19
    100983212 (TNFRSF1A)
   05164 Influenza A
    100983212 (TNFRSF1A)
   05168 Herpes simplex virus 1 infection
    100983212 (TNFRSF1A)
   05163 Human cytomegalovirus infection
    100983212 (TNFRSF1A)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100983212 (TNFRSF1A)
   05165 Human papillomavirus infection
    100983212 (TNFRSF1A)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100983212 (TNFRSF1A)
   05152 Tuberculosis
    100983212 (TNFRSF1A)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100983212 (TNFRSF1A)
   05142 Chagas disease
    100983212 (TNFRSF1A)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100983212 (TNFRSF1A)
   05014 Amyotrophic lateral sclerosis
    100983212 (TNFRSF1A)
   05022 Pathways of neurodegeneration - multiple diseases
    100983212 (TNFRSF1A)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100983212 (TNFRSF1A)
   05418 Fluid shear stress and atherosclerosis
    100983212 (TNFRSF1A)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100983212 (TNFRSF1A)
   04931 Insulin resistance
    100983212 (TNFRSF1A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:pps04050]
    100983212 (TNFRSF1A)
   04090 CD molecules [BR:pps04090]
    100983212 (TNFRSF1A)
Cytokine receptors [BR:pps04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   100983212 (TNFRSF1A)
CD molecules [BR:pps04090]
 Proteins
  100983212 (TNFRSF1A)
SSDB
Motif
Pfam: TNFR_c6 Death
Other DBs
NCBI-GeneID: 100983212
NCBI-ProteinID: XP_008971992
UniProt: A0A2R8ZK33
Position
12
AA seq 455 aa
MGLSTVPDLLLPLVLLELLVGIYPSGVIGLVPHLGDREKRDSVCPQGKYIHPQNNSICCT
KCHKGTYLYNDCPGPGQDTDCRECESGSFTASENHLRHCLSCSKCRKEMGQVEISSCTVD
RDTVCGCRKNQYRHYWSENLFQCFNCSLCLNGTVHLSCQEKQNTVCTCHAGFFLRENDCV
SCSNCKKSLECTKLCLPQIENVKGTEDSGTTVLLPLVIFFGLCLLSLLFIGLMYRYQRWK
SKLYSIVCGKSTPEKEGELEGTTTKPLAPTPSFSPTPGFTPTLGFSPVPSSTFTSSSTYT
PGDCPNFAAPRREVAPPYQGADPILATALASDPIPNPLQKWEDSAHKPQSLDTDDPATLY
AVVENVPPLRWKEFVRRLGLSDHEIDRLELQNGRCLREAQYSMLATWRRRTPRREATLEL
LGRVLRDMDLLGCLEDIEEALCGPAALPPAPSLLR
NT seq 1368 nt   +upstreamnt  +downstreamnt
atgggcctctccaccgtgcctgacctgctgctgccactggtgctcctggagctgttggtg
ggaatatacccctcaggggttattggactggtccctcacctaggggacagggagaagaga
gatagtgtgtgtccccaaggaaaatatatccaccctcaaaataattctatttgctgtacc
aagtgccacaaaggaacctacttgtacaatgactgtccaggcccggggcaggatacggac
tgcagggagtgtgagagcggctccttcaccgcttcagaaaaccacctcagacactgcctc
agctgctccaaatgccgaaaggaaatgggtcaggtggagatctcttcttgcacagtggac
cgggacaccgtgtgtggctgcaggaagaaccagtaccggcattattggagtgaaaacctt
ttccagtgcttcaattgcagcctctgcctcaatgggaccgtgcacctctcctgccaggag
aaacagaacaccgtgtgcacctgccatgcagggttctttctaagagaaaacgactgtgtc
tcctgtagtaactgtaagaaaagcctggagtgcacgaagttgtgcctaccccagattgag
aatgttaagggcactgaggactcaggcaccacagtgctgttgcccctggtcatcttcttt
ggtctttgccttttatccctcctcttcattggtttaatgtatcgctaccaacggtggaag
tccaagctctactccattgtttgtgggaaatcgacacctgaaaaagagggggagcttgaa
ggaactactactaagcccctggccccaaccccaagcttcagtcccactccaggcttcacc
cccaccctgggcttcagtcccgtgcccagttccaccttcacctccagctccacctatacc
cccggtgactgtcccaactttgcggctccccgcagagaggtggcaccaccctatcagggg
gctgaccccatccttgcgacagccctcgcctccgaccccatccccaacccccttcagaag
tgggaggacagcgcccacaagccacagagcctagacactgatgaccccgcgacgctgtac
gccgtggtggagaacgtgcccccgttgcgctggaaggaattcgtgcggcgcctagggctg
agcgaccacgagatcgatcggctggagctgcagaacgggcgctgcctgcgcgaggcgcaa
tacagcatgctggcgacctggaggcggcgcacgccgcggcgcgaggccacgctggagctg
ctgggacgcgtgctccgcgacatggacctgctgggctgcctggaggacatcgaggaggcg
ctttgcggccccgccgccctcccgcccgcgcccagtcttctcagatga

DBGET integrated database retrieval system