KEGG   Pan paniscus (bonobo): 100983275
Entry
100983275         CDS       T02283                                 

Gene name
IL34
Definition
(RefSeq) interleukin 34
  KO
K22633  interleukin 34
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04060  Cytokine-cytokine receptor interaction
pps04061  Viral protein interaction with cytokine and cytokine receptor
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100983275 (IL34)
   04061 Viral protein interaction with cytokine and cytokine receptor
    100983275 (IL34)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pps04052]
    100983275 (IL34)
Cytokines and growth factors [BR:pps04052]
 Cytokines
  Interleukins
   100983275 (IL34)
SSDB
Motif
Pfam: IL34
Other DBs
NCBI-GeneID: 100983275
NCBI-ProteinID: XP_003829524
UniProt: A0A2R9CS46
Position
16
AA seq 242 aa
MPRGFTWLRYLGIFLGVALGNEPLEMWPLTQNEECTVTGFLRDKLQYRSRLQYMKHYFPI
NYKISVPYEGVFRIANVTRLQRAQVSERELRYLWVLVSLSATESVQDVLLEGHPSWKYLQ
EVQMLLLNVQQGLTDVEVSPKVESVLSLLNAPGPNLKLVRPKALLDNCFRVMELLYCSCC
KQSSVLNWQDCEVPSPQSCSPEPSLQYAATQLYPPPPWSPSSPPHSTGSVRPVRAQGEGL
LP
NT seq 729 nt   +upstreamnt  +downstreamnt
atgccccggggcttcacctggctgcgctatcttgggatcttccttggcgtggccttgggg
aatgagcctttggagatgtggcccttgacgcagaatgaggagtgcaccgtcacgggtttt
ctgcgggacaagctgcagtacaggagccgacttcagtacatgaaacactacttccccatc
aactacaagatcagtgtgccttacgagggggtgttcagaatcgccaacgtcaccaggctg
cagagggcccaggtgagcgagcgggagctgcggtatctgtgggtcttggtgagtctcagt
gccactgagtcggtgcaggacgtgctgctcgagggccacccatcctggaagtacctgcag
gaggtgcagatgctgctgctgaatgtccagcagggcctcacggatgtggaggtcagcccc
aaggtggaatccgtgttgtccctcttgaatgccccagggccgaacttgaagctggtgcgg
cccaaagccctgctggacaactgcttccgggtcatggagctgctgtactgctcctgctgt
aaacaaagctccgtcctaaactggcaggactgtgaggtgccaagtcctcagtcttgcagc
ccagagccctcattgcagtatgcggccacccagctgtaccctccgcccccgtggtccccc
agctccccgcctcactccacgggctcggtgaggccggtcagggcacagggcgagggcctc
ttgccctga

DBGET integrated database retrieval system