KEGG   Pan paniscus (bonobo): 100983460
Entry
100983460         CDS       T02283                                 

Gene name
ITGA4
Definition
(RefSeq) integrin subunit alpha 4
  KO
K06483  integrin alpha 4
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04151  PI3K-Akt signaling pathway
pps04510  Focal adhesion
pps04512  ECM-receptor interaction
pps04514  Cell adhesion molecules
pps04640  Hematopoietic cell lineage
pps04670  Leukocyte transendothelial migration
pps04672  Intestinal immune network for IgA production
pps04810  Regulation of actin cytoskeleton
pps05135  Yersinia infection
pps05140  Leishmaniasis
pps05165  Human papillomavirus infection
pps05410  Hypertrophic cardiomyopathy
pps05412  Arrhythmogenic right ventricular cardiomyopathy
pps05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100983460 (ITGA4)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    100983460 (ITGA4)
   04514 Cell adhesion molecules
    100983460 (ITGA4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100983460 (ITGA4)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100983460 (ITGA4)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100983460 (ITGA4)
   04670 Leukocyte transendothelial migration
    100983460 (ITGA4)
   04672 Intestinal immune network for IgA production
    100983460 (ITGA4)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100983460 (ITGA4)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100983460 (ITGA4)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    100983460 (ITGA4)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    100983460 (ITGA4)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    100983460 (ITGA4)
   05414 Dilated cardiomyopathy
    100983460 (ITGA4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pps04147]
    100983460 (ITGA4)
   04515 Cell adhesion molecules [BR:pps04515]
    100983460 (ITGA4)
   04090 CD molecules [BR:pps04090]
    100983460 (ITGA4)
Exosome [BR:pps04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100983460 (ITGA4)
  Exosomal proteins of other cancer cells
   100983460 (ITGA4)
Cell adhesion molecules [BR:pps04515]
 Integrins
  Integrin alpha subunits
   100983460 (ITGA4)
CD molecules [BR:pps04090]
 Proteins
  100983460 (ITGA4)
SSDB
Motif
Pfam: Integrin_alpha2 FG-GAP FG-GAP_3 Integrin_alpha DUF11
Other DBs
NCBI-GeneID: 100983460
NCBI-ProteinID: XP_003823587
UniProt: A0A2R9BC59
Position
2B
AA seq 1032 aa
MAWEARREPGPRRAAVRETVMLLLCLGVPTGRPYNVDTESALLYQGPPNTLFGYSVVLHS
HGANRWLLVGAPTANWLANASVTNPGAIYRCRIGKNPGQTCEQLQLGSPNGEPCGKTCLE
ERDNQWLGVTLSRQPGENGSIVTCGHRWKNIFYIKNENKLPTGGCYGMPPDLRTELSKRI
APCYQDYVKKFGENFASCQAGISSFYTKDLIVMGAPGSSYWTGSLFVYNITTNKYKAFLD
KQNQVKFGSYLGYSVGAGHFRSQHTTEVVGGAPQHEQIGKAYIFSIDEKELNILHEMKGK
KLGSYFGASVCAVDLNADGFSDLLVGAPMQSTIREEGRVFVYINSGSGAVMTAMETNLVG
SDKYAARFGESIVNLGDIDNDGFEDVAIGAPQEDDLQGAIYIYNGRADGISSTFSQRIEG
LQISKSLSMFGQSISGQIDADNNGYVDVAVGAFRSDSAVLLRTRPVVIVDASLRHPESVN
RTKFDCVENGWPSVCMDLTLCFSYKGKEVPGYIVLFYNMSLDVNRKAESPPRFYFSSNGT
SDVITGSIQVSSREANCRTHQAFMRKDVRDILTPIQIEAAYHLGPHVISKRSTEEFPPLQ
PILQQKKEKDIIKKTINFARFCAHENCSADLQVSAKIGFLKPHENKTYLAVGSMKTLMLN
VSLFNAGDDAYETTLHVKLPVGLYFIKILELEEKQINCEVTDNSGVVQLDCSIGYIYVDH
LSRIDISFLLDVSSLSRAEEDLSITVHATCENEEEMDNLKHSRVTVAIPLKYEVKLTVHG
FVNPTSFVYGSNDENEPETCMVEKMNLTFHVINTGNSMAPNVSVEIMVPNSFSPQTDKLF
NILDVQTTTGECHFENYQRVCALEQQKSAMQTLKGIVQFLSKTDKRLLYCIKADPHCLNF
LCNFGKMESGKEASVHIQLEGRPSILEMDETSALKFEIRATGFPEPNPRVIELNKDENVA
HVLLEGLHHQRPKRYFTIVIISSSLLLGLIVLLLISYVMWKAGFFKRQYKSILQEENRRD
SWSYINSKSNDD
NT seq 3099 nt   +upstreamnt  +downstreamnt
atggcttgggaagcgaggcgcgaacccggcccccgaagggccgccgtccgggagacggtg
atgctgttgctgtgcctgggggtcccgaccggccgcccctacaacgtggacactgagagc
gcgctgctttaccagggcccccccaacacgctgttcggctactcggtcgtgctgcacagc
cacggggcgaaccgatggctcctagtgggtgcgcccactgccaactggctcgccaacgct
tcagtgaccaatcccggggcgatttacagatgcaggatcggaaagaatcccggccagacg
tgcgaacagctccagctgggtagccctaatggagaaccttgtggaaagacttgcttggaa
gagagagacaatcagtggttgggggtcacactttccagacagccaggagaaaatggatcc
atcgtgacttgtgggcatagatggaaaaatatattttacataaagaatgaaaataagctc
cccactggtggttgctatggaatgccccctgatttacgaacagaactgagtaaaagaata
gctccatgttatcaagattatgtgaaaaaatttggagaaaattttgcatcatgtcaagct
ggaatatccagtttttacacaaaggatttaattgtgatgggggccccaggatcatcttac
tggactggctctctttttgtctacaatataactacaaataaatacaaggcttttttagac
aaacaaaatcaagtaaaatttggaagttatttaggatattcagtcggagctggtcatttt
cggagccagcatactaccgaagtagtcggaggagctcctcaacatgagcagattggtaag
gcatatatatttagcattgatgaaaaagaactaaatatcttacatgaaatgaaaggtaaa
aagcttggatcgtactttggagcttctgtctgtgctgtggacctcaatgcagacggcttc
tcagatctgctcgtgggagcacccatgcagagcaccatcagagaggaaggaagagtgttt
gtgtacatcaactctggctcgggagcagtaatgactgcaatggaaacaaacctcgttgga
agtgacaaatatgctgcaagatttggggaatctatagttaatcttggcgacattgacaat
gatggctttgaagatgttgctatcggagctccacaagaagatgacttgcaaggtgctatt
tatatttacaatggccgtgcagatgggatctcgtcaaccttctcacagagaattgaagga
cttcagatcagcaaatcgttaagtatgtttggacagtctatatcaggacaaattgatgca
gataataatggctatgtagatgtagcagttggtgcttttcggtctgattctgctgtcttg
ctaaggacaagacctgtagtaattgttgacgcttctttaaggcaccctgagtcagtaaat
agaacgaaatttgactgtgttgaaaatggatggccttctgtgtgcatggatctaacactt
tgtttctcatataagggcaaggaagttccaggttacattgttttgttttataacatgagt
ttggatgtgaacagaaaggcagagtctccaccaagattctatttttcttctaatggaact
tctgacgtgattacaggaagcatacaagtgtccagcagagaagctaactgtagaacacat
caagcatttatgcggaaagatgtgcgggacatcctcaccccaattcagattgaagctgct
taccaccttggtcctcatgtcatcagtaaacgaagtacagaggaattcccaccacttcag
ccaattcttcagcagaagaaagaaaaagacataattaaaaaaacaataaactttgcaagg
ttttgtgcccatgaaaattgttctgctgatttacaggtttctgcaaagattgggtttttg
aagccccatgaaaataaaacatatcttgctgttgggagtatgaagacattgatgttgaat
gtgtccttgtttaatgctggagatgatgcatatgaaacgactctacatgtcaaactaccc
gtgggtctttatttcattaagattttagagctggaagagaagcaaataaactgtgaagtc
acagataactctggcgtggtacaacttgactgcagtattggctatatatatgtagatcat
ctctcaaggatagatattagctttctcctggatgtgagctcactcagcagagcggaagag
gacctcagtatcacagtgcatgctacctgtgaaaatgaagaggaaatggacaatctaaag
cacagcagagtgactgtagcaatacctttaaaatatgaggttaagctgactgttcatggg
tttgtaaacccaacttcatttgtgtatggatcaaatgatgaaaatgagcctgaaacgtgc
atggtggagaaaatgaacttaactttccatgttatcaacactgggaatagcatggctccc
aatgttagtgtggaaataatggtaccaaattcttttagcccccaaacggataagctgttc
aacattttggatgtccagactactactggagaatgccactttgaaaattatcaaagagtg
tgtgcattagagcagcaaaagagtgcaatgcagaccttgaaaggcatagtccagttcttg
tccaagactgataagaggctattgtactgcataaaagctgatccacattgtttaaatttc
ctgtgtaattttgggaaaatggaaagtggaaaagaagccagtgttcatatccaactggaa
ggccggccatccattttagaaatggatgagacttcagcactcaagtttgaaataagagca
acaggttttccagagccaaatccaagagttattgaactaaacaaggatgagaatgttgca
catgttctactggaaggactacatcatcaaagacccaaacgttatttcaccatagtgatt
atttcaagtagcttgctacttggacttattgtacttctgttgatctcatatgttatgtgg
aaggctggcttctttaaaagacaatacaaatctatcctacaagaagaaaacagaagagac
agttggagttatatcaacagtaaaagcaatgatgattaa

KEGG   Pan paniscus (bonobo): 100989804
Entry
100989804         CDS       T02283                                 

Gene name
ITGB7
Definition
(RefSeq) integrin subunit beta 7
  KO
K06590  integrin beta 7
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04151  PI3K-Akt signaling pathway
pps04510  Focal adhesion
pps04512  ECM-receptor interaction
pps04514  Cell adhesion molecules
pps04672  Intestinal immune network for IgA production
pps04810  Regulation of actin cytoskeleton
pps05165  Human papillomavirus infection
pps05202  Transcriptional misregulation in cancer
pps05410  Hypertrophic cardiomyopathy
pps05412  Arrhythmogenic right ventricular cardiomyopathy
pps05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100989804 (ITGB7)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    100989804 (ITGB7)
   04514 Cell adhesion molecules
    100989804 (ITGB7)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100989804 (ITGB7)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100989804 (ITGB7)
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    100989804 (ITGB7)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    100989804 (ITGB7)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100989804 (ITGB7)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    100989804 (ITGB7)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    100989804 (ITGB7)
   05414 Dilated cardiomyopathy
    100989804 (ITGB7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pps04147]
    100989804 (ITGB7)
   04515 Cell adhesion molecules [BR:pps04515]
    100989804 (ITGB7)
Exosome [BR:pps04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100989804 (ITGB7)
Cell adhesion molecules [BR:pps04515]
 Integrins
  Integrin beta subunits
   100989804 (ITGB7)
SSDB
Motif
Pfam: Integrin_beta Integrin_b_cyt PSI_integrin I-EGF_1 EGF_2
Other DBs
NCBI-GeneID: 100989804
NCBI-ProteinID: XP_003831078
UniProt: A0A2R9BLF7
Position
12
AA seq 798 aa
MVALPMVFVLLLVLSRGESELDAKIPSTGDATEWRNPHLSMLGSCQPAPSCQKCILSHPS
CAWCKQLNFTASGEAEARRCARREELLARGCPLEELEEPRGQQEVLQDQPLSQGARGEGA
TQLAPQRVRVTLRPGEPQQLQVRFLRAEGYPVDLYYLMDLSYSMKDDLERVRQLGHALLV
RLQEVTHSVRIGFGSFVDKTVLPFVSTVPSKLRHPCPTRLERCQSPFSFHHVLSLTGDAQ
AFEREVGRQSVSGNLDSPEGGFDAILQAALCQEQIGWRNVSRLLVFTSDDTFHTAGDGKL
GGIFMPSDGHCHLDSNGLYSRSTEFDYPSVGQVAQALSAANIQPIFAVTSAALPVYQELS
KLIPKSAVGELSEDSSNVVQLIMDAYNSLSSTVTLEHSSLPPGVHISYESQCEGPEKREG
KAEDRGQCNHVRINQTVTFWVSLQATHCLPEPHLLRLRALGFSEELIVELHTLCDCNCSD
TQPQAPHCSDGQGHLQCGVCSCAPGRLGRLCECSVAELSSPDLESGCRAPNGTGPLCSGK
GHCQCGRCSCSGQSSGHLCECDDASCERHEGILCGGFGRCQCGVCHCHANRTGRACECSG
DMDSCISPEGGLCSGHGRCKCNRCQCLDGYYGALCDQCPGCKTPCERHRDCAECGAFGTG
PLATNCSTACAHTNVTLALAPILDDGWCKERTLDNQLFFFLVEDDARGTVVLRVRPQEKG
ADHTQAIVLGCVGGIVAVGLGLVLAYRLSVEIYDRREYSRFEKEQQQLNWKQDSNPLYKS
AITTTINPRFQEADSPTL
NT seq 2397 nt   +upstreamnt  +downstreamnt
atggtggctttgccaatggtctttgttttgctgctggtcctgagcagaggtgagagtgaa
ttggacgccaagatcccatccacaggggatgccacagaatggcggaatcctcacctgtcc
atgctggggtcctgccagccagccccctcctgccagaagtgcatcctctcacaccccagc
tgtgcatggtgcaagcaactgaacttcaccgcgtcgggagaggcggaggcgcggcgctgc
gcccgacgagaggagctgctggctcgaggctgcccgctggaggagctggaggagccccgc
ggccagcaggaggtgcttcaggaccagccgctcagccagggcgcccgcggagagggtgcc
acccagctggcgccgcagcgggtccgggtcacgctgcggcctggggagccccagcagctc
caggtccgcttccttcgtgctgagggatacccggtggacctgtactaccttatggacctg
agctactccatgaaggacgacctggaacgcgtgcgccagctcgggcacgctctgctggtc
cggctgcaggaagtcacccattctgtgcgcattggttttggttcctttgtggacaaaaca
gtgctgccctttgtgagcacagtaccctccaagctgcgccacccctgccccacccggctg
gagcgctgccagtcacccttcagctttcaccatgtgctgtccctgacgggggacgcacaa
gccttcgagcgggaggtggggcgccagagtgtgtccggcaatctggactcgcctgaaggt
ggctttgatgccattctgcaggctgcactctgccaggagcagattggctggagaaatgtg
tcccggctgctggtgttcacttcagatgacacattccatacagctggggacgggaagttg
ggcggcattttcatgcccagtgatgggcactgccacttggacagcaatggcctctacagt
cgcagcacagagtttgactacccttctgtgggtcaggtagcccaggccctctctgcagcc
aatatccagcccatctttgctgtcaccagtgccgcactgcctgtctaccaggagctgagt
aagctgattcctaagtctgcagttggggagctgagtgaggactccagcaacgtggtacag
ctcatcatggatgcttataatagcctgtcttccaccgtgacccttgaacactcttcactc
cctcctggggtccacatttcttacgaatcccagtgtgagggtcctgagaagagggagggt
aaggctgaggatcgaggacagtgcaaccacgtccgaatcaaccagacggtgactttctgg
gtttctctccaagccacccactgcctcccagagccccatctcctgaggctccgggccctt
ggcttctcagaggagctgattgtggagttgcacacgctgtgtgactgtaattgcagtgac
acccagccccaggctccccactgcagtgatggccagggacacctacaatgtggtgtatgc
agctgtgcccctggccgcctaggtcggctctgtgagtgctctgtggcagagctgtcctcc
ccagacctggaatctgggtgccgggctcccaatggcacagggcccctgtgcagtggaaag
ggtcactgtcaatgtggacgctgcagctgcagtggacagagctctgggcatctgtgcgag
tgtgatgatgccagctgtgagcgacatgagggcatcctctgcggaggctttggtcgctgc
caatgtggagtatgtcactgtcatgccaaccgcacgggcagagcatgcgaatgcagtggg
gacatggacagttgcatcagtcccgagggagggctctgcagtgggcatggacgctgcaaa
tgcaaccgctgccagtgcttggacggctactatggtgctctatgcgaccaatgcccaggc
tgcaagacaccatgcgagagacaccgggactgtgcagagtgtggggccttcgggactggc
ccactggccaccaactgcagtacagcttgtgcccataccaatgtgaccctggccttggcc
cctatcttggatgatggctggtgcaaagagaggaccctggacaaccagctgttcttcttc
ttggtggaggatgacgccagaggcacggtcgtgctcagagtgagaccccaagaaaaggga
gcagaccacacccaggccattgtgctgggctgcgtagggggcatcgtggcagtggggctg
gggctggtcctggcttaccggctctcggtggaaatctatgaccgccgggaatacagtcgc
tttgagaaggagcagcaacaactcaactggaagcaggacagtaatcctctctacaaaagt
gccatcacgaccaccatcaatcctcgctttcaagaggcagacagtcccactctctga

DBGET integrated database retrieval system