KEGG   Pan paniscus (bonobo): 100983504
Entry
100983504         CDS       T02283                                 

Gene name
OTUB1
Definition
(RefSeq) OTU deubiquitinase, ubiquitin aldehyde binding 1
  KO
K09602  ubiquitin thioesterase protein OTUB1 [EC:3.4.19.12]
Organism
pps  Pan paniscus (bonobo)
Brite
KEGG Orthology (KO) [BR:pps00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:pps01002]
    100983504 (OTUB1)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:pps04121]
    100983504 (OTUB1)
Enzymes [BR:pps01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100983504 (OTUB1)
Peptidases and inhibitors [BR:pps01002]
 Cysteine peptidases
  Family C65
   100983504 (OTUB1)
Ubiquitin system [BR:pps04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   OTU
    100983504 (OTUB1)
SSDB
Motif
Pfam: Peptidase_C65 OTU RE_XcyI Lipoprotein_7
Other DBs
NCBI-GeneID: 100983504
NCBI-ProteinID: XP_008952192
UniProt: A0A2R8ZEY0
Position
11
AA seq 280 aa
MAAEEPQQQKQEPLGSDSEGVNCLAYDEAIMAQQDRIQQEDMTDPCLLQIAVQNPLVSER
LELSVLYKEYAEDDNIYQQKIKDLHKKYSYIRKTRPDGNCFYRAFGFSHLEALLDDSKEL
QRFKAVSAKSKEDLVSQGFTEFTIEDFHNTFMDLIEQVEKQTSVADLLASFNDQSTSDYL
VVYLRLLTSGYLQRESKFFEHFIEGGRTVKEFCQQEVEPMCKESDHIHIIALAQALSVSI
QVEYMDRGEGGTTNPHIFPEGSEPKVYLLYRPGHYDILYK
NT seq 843 nt   +upstreamnt  +downstreamnt
atggcggcggaggaacctcagcagcagaagcaggagccgctgggcagcgactccgaaggt
gttaactgtctggcctatgatgaagccatcatggctcagcaggaccgaattcagcaagag
gacatgacagatccctgcctcctccagattgctgtgcagaaccctctggtgtcagagcgg
ctggagctctcggtcctatacaaggagtatgctgaagatgacaacatctatcaacagaag
atcaaggacctccacaaaaagtactcgtacatccgcaagaccaggcctgacggcaactgt
ttctatcgggcttttggattctcccacttggaggcactgctggatgacagcaaggagttg
cagcggttcaaggctgtgtctgccaagagcaaggaagacctggtgtcccagggcttcact
gaattcacaattgaggatttccacaacacgttcatggacctgattgagcaggtggagaag
cagacctctgtcgccgacctgctggcctccttcaatgaccagagcacctccgactatctt
gtggtctacctgcggctgctcacctcgggctacctgcagcgcgagagcaagttcttcgag
cacttcatcgaaggtggacggactgtcaaggagttctgccagcaggaggtggagcccatg
tgcaaggagagcgaccacatccacatcattgcgctggcgcaggccctcagcgtgtccatc
caggtggagtacatggaccgcggcgagggcggcaccaccaatccgcacatcttccccgag
ggctccgagcccaaggtctaccttctctaccggcctggacactacgatatcctctacaaa
tag

DBGET integrated database retrieval system