KEGG   Pan paniscus (bonobo): 100983572
Entry
100983572         CDS       T02283                                 

Gene name
SNX14
Definition
(RefSeq) sorting nexin 14
  KO
K17926  sorting nexin-14
Organism
pps  Pan paniscus (bonobo)
Brite
KEGG Orthology (KO) [BR:pps00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99992 Structural proteins
    100983572 (SNX14)
SSDB
Motif
Pfam: PXA PX Nexin_C RGS
Other DBs
NCBI-GeneID: 100983572
NCBI-ProteinID: XP_003822885
UniProt: A0A2R9BRD1
Position
6
AA seq 946 aa
MVPWVRTMGQKLKQRLRLDVGREICRQYPLFCFLLLCLSAASLLLNRYIHILMIFWSFVA
GVVTFYCSLGPDSLLPNIFFTIKYKPKQLGLQELFPQGHSCAVCGKVKCKRHRPSLLLEN
YQPWLDLKISSKVDASLSEVLELVLENFVYPWYRDVTDDESFVDELRITLRFFASVLIRR
IHKVDIPSIITKKLLKAAMKHIEVIVKARQKVKNTEFLQQAALEEYGPELHVALRSRRDE
LHYLRKLTELLFPYILPPKATDCRSLTLLIREILSGSVFLPSLDFLADPDTVNHLLIIFI
DDSPPEKATEPASPLVPFLQKFAEPRNKKPSVLKLELKQIREQQDLLFRFMNFLKQEGAV
HVLQFCLTVEEFNDRILRPELSNDEMLSLHEELQKIYKTYCLDESIDKIRFDPFIVEEIQ
RIAEGPYIDVVKLQTMRCLFEAYEHVLSLLENVFTPMFCHSDEYFRQLLRGAESPTRNSK
LNRGSLSLDDFRNTQKRGESFGISRIGSKIKGVFKSTTMEGAMLPNYGVAEGEDDFIEEG
IVVMEDDSPVEAVSTPNTPRNLAAWKISIPYVDFFEDPSSERKEKKERIPVFCIDVERND
RRAVGHEPEHWSVYRRYLEFYVLESKLTEFHGAFPDAQLPSKRIIGPKNYEFLKSKREEF
QEYLQKLLQHPELSNSQLLADFLSPNGGETQFLDKILPDVNLGKIIKSVPGKLMKEKGQH
LEPFIMNFINSCESPKPKPSRPELTILSPTSENNKKLFNDLFKNNANRAENTERKQNQNY
FMEVMTVEGVYDYLMYVGRVVFQVPDWLHHLLMGTRILFKNTLEMYTDYYLQCKLEQLFQ
EHRLVSLITLLRDAIFCENTEPRSLQDKQKGAKQTFEEMMNYIPDLLVKCIGEETKYESI
RLLFDGLQQPVLNKQLTYVLLDIVIQELFPELNKVQKEVTSVTSWM
NT seq 2841 nt   +upstreamnt  +downstreamnt
atggtgccctgggtgcggacgatggggcagaagctgaagcagcggctgcgactggacgtg
ggacgcgagatctgccgccagtacccgctgttctgcttcctgctgctctgtctcagcgcc
gcctccctgcttcttaacaggtatattcatattttaatgatcttctggtcatttgttgct
ggagttgtcacattctactgctcactaggacctgattctctcttaccaaatatattcttc
acaataaaatacaaacccaagcagttaggacttcaggaattatttcctcaaggtcatagc
tgtgctgtttgtggtaaagtgaaatgtaaacgacataggccttctttgctacttgaaaac
taccagccatggctagacctgaaaatttcttccaaggttgatgcatctctctcagaggtt
cttgaattagtgttggaaaactttgtttatccgtggtacagggatgtgacagatgatgaa
tcctttgttgatgaactgagaataacattacgtttttttgcatctgtcttaataagaagg
attcacaaggtggatattccatctattataaccaagaaactattaaaagcagcaatgaag
catatagaagtgatagttaaagccagacagaaagtaaaaaatacagagtttttacagcaa
gctgctttagaagaatatggtccagagcttcatgttgctttgagaagtcgaagagatgaa
ttgcactatttaaggaaacttactgaactgctttttccttatattttgcctcctaaagca
acagactgcagatctctgaccttacttataagagagattctgtctggctctgtgttcctt
ccttctttggatttcctagctgatccagatactgtgaatcatttgcttatcatcttcata
gatgacagtccacctgaaaaagcaactgaaccggcttctcctttggttccattcttgcag
aaatttgcagaacctagaaataaaaagccatctgtgctgaagttagaattgaagcaaatc
agagagcaacaagatcttttatttcgttttatgaactttctgaaacaagaaggcgcagtg
cacgtgttgcagttttgtttgactgtggaggaatttaatgatagaattttacgaccagaa
ttatcaaatgatgaaatgctgtctcttcatgaagaattgcagaagatttataaaacatac
tgtttggatgaaagtattgacaaaattagatttgatcccttcattgtagaagagattcaa
agaattgctgaaggcccatacatagatgttgtgaaacttcaaactatgagatgtcttttt
gaagcatatgaacatgttctttcccttttggagaatgtatttactcctatgttctgccat
agtgatgagtatttcagacaacttttaagaggtgcagaatcaccaacacgcaattcaaaa
ttgaacagaggtagcctaagtttggatgattttcggaacacacagaaaaggggagaatca
tttggaatcagcagaataggtagcaaaattaaaggagtattcaaaagtaccacaatggag
ggagctatgttgcctaattatggtgtagctgaaggtgaagatgattttattgaagaaggt
attgttgtaatggaagatgattctccagtggaggctgtgagcacacctaatactccccga
aaccttgctgcatggaaaattagcattccatatgtagacttttttgaggatccctcctct
gaaaggaaagagaaaaaagaaagaattcctgtattttgtattgatgttgaaagaaatgat
agaagagcagttggacacgagcctgaacattggtctgtctatagaagatatcttgaattc
tatgtacttgaatcaaaactaacagaatttcatggtgcatttcctgatgcccagcttcct
tctaagaggatcattggccccaaaaattatgaattcttaaagtcaaagagggaagagttc
caagaatatctacagaaacttctgcagcatccagaactgagtaatagtcaacttctggca
gactttctttcccctaatggtggggaaacacaatttcttgataagatactaccagatgta
aatcttgggaaaattataaaatctgttcctggaaaactaatgaaagagaaaggtcagcat
ttggaaccttttatcatgaatttcattaattcttgtgagtctccaaagcctaaaccaagt
agaccagaactgaccattctcagccctacttcagaaaacaacaagaagcttttcaatgat
ctgtttaaaaataatgcaaaccgtgctgaaaatacagagagaaagcaaaatcagaattat
tttatggaggtgatgactgtagaaggagtctatgattacctgatgtatgtaggacgggta
gttttccaggttcctgactggcttcatcatctcttaatgggaactcgaatcctctttaaa
aacaccctggaaatgtatactgattactatcttcagtgtaaactagaacagctatttcag
gagcaccgtttggtctcactcataacacttctcagagatgctatattctgtgaaaacact
gaacctcgctctctccaagataagcaaaaaggagcaaaacagacttttgaagaaatgatg
aattacattccagatctgttagtcaagtgtattggtgaagaaaccaagtatgaaagcatc
agacttctgtttgatggcttacagcaaccagtactcaacaagcagctgacttatgtttta
ttggacattgtgatacaggaactgtttccagagctcaataaggtacaaaaggaagttacc
tctgtgacatcttggatgtaa

DBGET integrated database retrieval system