KEGG   Pan paniscus (bonobo): 100983770Help
Entry
100983770         CDS       T02283                                 

Gene name
NPR1
Definition
(RefSeq) natriuretic peptide receptor 1
  KO
K12323  atrial natriuretic peptide receptor A [EC:4.6.1.2]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps00230  Purine metabolism
pps01100  Metabolic pathways
pps04022  cGMP-PKG signaling pathway
pps04024  cAMP signaling pathway
pps04270  Vascular smooth muscle contraction
pps04714  Thermogenesis
pps04921  Oxytocin signaling pathway
pps04923  Regulation of lipolysis in adipocytes
pps04924  Renin secretion
pps04925  Aldosterone synthesis and secretion
Brite
KEGG Orthology (KO) [BR:pps00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100983770 (NPR1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    100983770 (NPR1)
   04022 cGMP-PKG signaling pathway
    100983770 (NPR1)
 09150 Organismal Systems
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    100983770 (NPR1)
   04921 Oxytocin signaling pathway
    100983770 (NPR1)
   04924 Renin secretion
    100983770 (NPR1)
   04925 Aldosterone synthesis and secretion
    100983770 (NPR1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100983770 (NPR1)
  09159 Environmental adaptation
   04714 Thermogenesis
    100983770 (NPR1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pps01001]
    100983770 (NPR1)
Enzymes [BR:pps01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     100983770 (NPR1)
Protein kinases [BR:pps01001]
 Serine/threonine kinases: Other
  RGC family [OT]
   100983770 (NPR1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc ANF_receptor Pkinase_Tyr Pkinase HNOBA
Motif
Other DBs
NCBI-GeneID: 100983770
NCBI-ProteinID: XP_003817195
Position
1
AA seq 1061 aa AA seqDB search
MPGPRRPAGSRLRLLLLLLLPLLLLLLRGSHADNLTVAVVLPLANTSYPWSWARVGPAVE
LALAQVKARPDLLPGWTVRTVLGSSENALGVCSDTAAPLAAVDLKWEHNPXVFLGPGCVY
AAAPVGRFTAHWRVPLLTAGAPALGFGVKDEYALTTRAGPSYAKLGDFVAALHRRLGWER
QALMLYAYRPGDEEHCFFLVEGLFMRVRDRLNITVDHLEFAEDDLSHYTRLLRTMPRKGR
VIYICSSPDAFRTLMLLALEAGLCGEDYVFFHLDIFGQSLQGGQGPAPRRPWERGDGQDV
SARQAFQAAKIITYKDPDNPEYLEFLKQLKHLAYEQFNFTMEDGLVNTIPASFHDGLLLY
IQAVTETLAHGGTVTDGENITQRMWNRSFQGVTGYLKIDSSGDRETDFSLWDMDPENGAF
RVVLNYNGTSQELVAVSGRKLNWPLGYPPPDIPKCGFDNEDPACNQDHLSTLEVLALVGS
LSLLGILIVSFFIYRKMQLEKELASELWRVRWEDVEPSSLERHLRSAGSRLTLSGRGSNY
GSLLTTEGQFQVFAKTAYYKGNLVAVKRVNRKRIELTRKVLFELKHMRDVQNEHLTRFVG
ACTDPPNICILTEYCPRGSLQDILENESITLDWMFRYSLTNDIVKGMLFLHNGAICSHGN
LKSSNCVVDGRFVLKITDYGLESFRDLDPEQGHTVYAKKLWTAPELLRMASPPVRGSQAG
DVYSFGIILQEIALRSGVFHVEGLDLSPKEIIERVTRGEQPPFRPSLALQSHLEELGLLM
QRCWAEDPQERPPFQQIRLTLRKFNRENSSNILDNLLSRMEQYANNLEELVEERTQAYLE
EKRKAEALLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTALSAESTPMQVVTL
LNDLYTCFDAVIDNFDVYKVETIGDAYMVVSGLPVRNGRLHACEVARMALALLDAVRSFR
IRHRPQEQLRLRIGIHTGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGEALKIHLSSET
KAVLEEFGGFELELRGDVEMKGKGKVRTYWLLGERGSSTRG
NT seq 3186 nt NT seq  +upstreamnt  +downstreamnt
atgccggggccccggcgccccgctggctcccgcctgcgcctgctcctgctcctgctgctg
ccgctgctgctgctgctgctccggggcagccacgcggacaacctgacggtagccgtggta
ctgccgctggccaatacctcgtacccgtggtcgtgggcgcgcgtgggacccgccgtggag
ctggccctggcccaggtgaaggcgcgccccgacttgctgccgggctggacggtccgcacg
gtgctgggcagcagcgaaaacgcgctgggcgtctgctccgacaccgcagcgcccctggcc
gcggtggacctcaagtgggagcacaacccgnctgtgttcctgggccccggctgcgtgtac
gccgccgccccagtggggcgcttcaccgcgcactggcgggtcccgctgctgaccgccggc
gccccggcgctgggcttcggtgtcaaggacgagtatgcgctgaccacccgcgcggggccc
agctacgccaagctgggggacttcgtggcggcgctgcaccgacggctgggctgggagcgc
caagcgctcatgctctacgcctaccggccgggtgacgaagagcactgcttcttcctcgtg
gaggggctgttcatgcgggtccgcgaccgcctcaatattacggtggaccacctggagttc
gccgaggacgacctcagccactacaccaggctgctgcggaccatgccgcgcaaaggccga
gttatctacatctgcagctcccctgatgccttcagaaccctcatgctcctggccctggaa
gctggcttgtgtggggaggactacgttttcttccacctggatatctttgggcaaagcctg
caaggtggacagggccctgctccccgcaggccctgggagagaggggatgggcaggatgtc
agtgcccgccaggcctttcaggctgccaaaatcattacatataaagacccagataatccc
gagtacttggaattcctgaagcagttaaaacacctggcctatgagcagttcaacttcacc
atggaggatggcctggtgaacaccatcccagcatccttccacgacgggctcctgctctat
atccaggcagtgacggagactctggcacatgggggaactgtcactgatggggagaacatc
actcagcggatgtggaaccgaagctttcaaggtgtgacaggatacctgaaaattgatagc
agtggcgatcgggaaacagacttctccctctgggatatggatcccgagaatggtgccttc
agggttgtactgaactacaatgggacttcccaagagctggtggctgtgtcggggcgcaaa
ctgaactggcccctggggtaccctcctcctgacatccccaaatgtggctttgacaacgaa
gacccagcatgcaaccaagatcacctttccaccctggaggtgctggctttggtgggcagc
ctctccttgctcggcattctgattgtctccttcttcatatacaggaagatgcagctggag
aaggaactggcctcggagctgtggcgggtgcgctgggaggacgttgagcccagtagcctt
gagaggcacctgcggagtgcaggcagccggctgaccctgagcgggagaggctccaattac
ggctccctgctaaccacagagggccagttccaagtctttgccaagacagcatattataag
ggcaacctcgtggctgtgaaacgtgtgaaccgtaaacgcattgagctgacacgaaaagtc
ctgtttgaactgaagcatatgcgggatgtgcagaatgaacacctgaccaggtttgtggga
gcctgcaccgacccccccaatatctgcatcctcacagagtactgtccccgtgggagcctg
caggacattctggagaatgagagcatcaccctagactggatgttccggtactcactcacc
aatgacatcgtcaagggcatgctgtttctacacaatggggctatctgttcccatgggaac
ctcaagtcatccaactgcgtggtagatgggcgctttgtgctcaagatcaccgactatggg
ctggagagcttcagggacctggacccagagcaaggacacaccgtttatgccaaaaagctg
tggacagcccctgagctcctgcgaatggcttcaccccctgtgcggggctcccaggctggt
gacgtatacagctttgggatcatccttcaggagattgccctgaggagtggggtcttccac
gtggaaggtttggacctgagccccaaagagatcatcgagcgggtgactcggggtgagcag
ccccccttccggccctccctggccctgcagagtcacctggaggagttggggctgctgatg
cagcggtgctgggctgaggacccacaggagaggccaccattccagcagatccgcctgacg
ttgcgcaagtttaacagggagaacagcagcaacatcctggacaacctgctgtcccgcatg
gagcagtacgcgaacaatctggaggaactggtggaggagcggacccaggcatacctggag
gagaagcgcaaggccgaggccctgctctaccagatcctgcctcactcagtggctgagcag
ctgaagcgtggggagaccgtgcaggccgaagcctttgacagcgttaccatctacttcagt
gacattgtgggtttcacagcgctgtcggcggagagcacacccatgcaggtggtgaccctg
ctcaatgacctgtacacttgctttgatgctgtcatagacaactttgatgtgtacaaggtg
gagacaattggcgatgcctacatggtggtgtcggggctccctgtgcggaacgggcggcta
cacgcctgcgaggtagcccgcatggccctagcactgctggatgctgtgcgctccttccga
atccgccaccggccccaggagcagctgcgcttgcgcattggcatccacacaggacctgtg
tgtgctggagtggtgggactgaagatgccccgttactgtctctttggggatacagtcaac
acagcctcaagaatggagtctaatggggaagccctgaagatccacttgtcttctgagacc
aaggctgtcctggaggagtttggtggtttcgagctggagcttcgaggggatgtagaaatg
aagggcaaaggcaaggttcggacctactggctccttggggagcgggggagtagcacccga
ggctga

DBGET integrated database retrieval system