KEGG   Pan paniscus (bonobo): 100983801
Entry
100983801         CDS       T02283                                 

Gene name
CPE
Definition
(RefSeq) carboxypeptidase E
  KO
K01294  carboxypeptidase E [EC:3.4.17.10]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04940  Type I diabetes mellitus
Brite
KEGG Orthology (KO) [BR:pps00001]
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100983801 (CPE)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:pps01002]
    100983801 (CPE)
Enzymes [BR:pps01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.17  Metallocarboxypeptidases
    3.4.17.10  carboxypeptidase E
     100983801 (CPE)
Peptidases and inhibitors [BR:pps01002]
 Metallo peptidases
  Family M14: carboxypeptidase A family
   100983801 (CPE)
SSDB
Motif
Pfam: Peptidase_M14 CarboxypepD_reg CarbopepD_reg_2 AstE_AspA
Other DBs
NCBI-GeneID: 100983801
NCBI-ProteinID: XP_008973520
Position
4
AA seq 417 aa
MDEAETSRTTGLIEITLLLRSAISLLLLKCNGESHKQATVTFVSEPEFKYIGNMHGNEAV
GRELLIFLAQYLCNEYQKGNETIVNLIHSTRIHIMPSLNPDGFEKAASQPGELKDWFVGR
SNAQGIDLNRNFPDLDRIVYVNEKEGGPNNHLLKNMKKIVDQNTKLAPETKAVIHWIMDI
PFVLSANLHGGDLVANYPYDETRSGSAHEYSSSPDDAIFQSLARAYSSFNPAMSDPNRPP
CRKNDDDSSFVDGTTNGGAWYSVPGGMQDFNYLSSNCFEITVELSCEKFPPEETLKTYWE
DNKNSLISYLEQIHRGVKGFVRDLQGNPIANATISVEGIDHDVTSAKDGDYWRLLIPGNY
KLTASAPGYLAVTKKVAVPYSPAAGVDFELESFSERKEEEKEELMEWWKMMSETLNF
NT seq 1254 nt   +upstreamnt  +downstreamnt
atggatgaagcagaaacgagcagaacaacaggattaattgagatcactttgctgctacgt
tctgcaatttcattactactcctaaaatgcaatggagagtctcacaaacaggcaacagtg
acttttgttagtgagcctgaatttaaatacattgggaatatgcatgggaatgaggctgtt
ggacgagaactgctcattttcttggcccagtacctatgcaacgaatatcagaaggggaac
gagacaattgtcaacctgatccacagtacccgcattcacatcatgccttccctgaaccca
gatggctttgagaaggcagcgtctcagcctggtgaactcaaggactggtttgtgggtcga
agcaatgcccagggaatagatctgaaccggaactttccagacctggataggatagtgtac
gtgaatgagaaagaaggtggtccaaataatcatctgttgaaaaatatgaagaaaattgtg
gatcaaaacacaaagcttgctcctgagaccaaggctgtcattcattggattatggatatt
ccttttgtgctctctgccaatctccatggaggagaccttgtggccaattatccatatgat
gagacgcggagtggtagtgctcacgaatacagctcctccccagatgacgccattttccaa
agcttggcccgggcatactcttctttcaacccggccatgtctgaccccaatcggccacca
tgtcgcaagaatgatgatgacagcagctttgtagatggaaccaccaatggtggtgcttgg
tacagtgtacctggagggatgcaagacttcaattaccttagcagcaactgttttgagatc
accgtggagcttagctgtgagaagttcccacctgaagagactctgaagacctactgggag
gataacaaaaactccctcattagctaccttgagcagatacaccgaggagttaaaggattt
gtccgagaccttcaaggtaacccaattgcgaatgccaccatctccgtggaaggaatagac
cacgatgttacatccgcaaaggatggtgattactggagattgcttatacctggaaactat
aaacttacagcctcggctccaggctatctggcagtaacaaagaaagtggcagttccttac
agccctgctgctggggttgattttgaactggagtcattttctgaaaggaaagaagaggag
aaggaagaattgatggaatggtggaaaatgatgtcagaaactttaaatttttaa

DBGET integrated database retrieval system