KEGG   Pan paniscus (bonobo): 100983866Help
Entry
100983866         CDS       T02283                                 

Gene name
BDNF
Definition
(RefSeq) brain derived neurotrophic factor
  KO
K04355  brain-derived neurotrophic factor
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04010  MAPK signaling pathway
pps04014  Ras signaling pathway
pps04024  cAMP signaling pathway
pps04151  PI3K-Akt signaling pathway
pps04722  Neurotrophin signaling pathway
pps05016  Huntington's disease
pps05030  Cocaine addiction
pps05034  Alcoholism
Brite
KEGG Orthology (KO) [BR:pps00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    100983866 (BDNF)
   04010 MAPK signaling pathway
    100983866 (BDNF)
   04024 cAMP signaling pathway
    100983866 (BDNF)
   04151 PI3K-Akt signaling pathway
    100983866 (BDNF)
 Organismal Systems
  Nervous system
   04722 Neurotrophin signaling pathway
    100983866 (BDNF)
 Human Diseases
  Neurodegenerative diseases
   05016 Huntington's disease
    100983866 (BDNF)
  Substance dependence
   05030 Cocaine addiction
    100983866 (BDNF)
   05034 Alcoholism
    100983866 (BDNF)
Cytokines and growth factors [BR:pps04052]
 Growth factors
  Growth factors (RTK binding)
   100983866 (BDNF)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NGF Spaetzle
Motif
Other DBs
NCBI-GeneID: 100983866
NCBI-ProteinID: XP_003830480
Position
11
AA seq 262 aa AA seqDB search
MQSREEEWFHQVRRVMTILFLTMVISYFGCMKAAPMKEANIRGQGGLAYPGVRTHGTLES
VNGPKAGSRGLTSLADTFEHVIEELLDEDQKVRPNEENNKDADLYTSRVMLSSQVPLEPP
LLFLLEEYKNYLDAANMSMRVRRHSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVT
VLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKR
IGWRFIRIDTSCVCTLTIKRGR
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgcagagccgggaagaggaatggttccaccaggtgagaagagtgatgaccatccttttc
cttactatggttatttcatacttcggttgcatgaaggctgcccccatgaaagaagcaaac
atccgaggacaaggtggcttggcctacccaggtgtgcggacccatgggactctggagagc
gtgaatgggcccaaggcaggttcaagaggcttgacatcgttggctgacactttcgaacac
gtgatagaagagctgttggatgaggaccagaaagttcggcccaatgaagaaaacaataag
gacgcagacttgtacacgtccagggtgatgctcagtagtcaagtgcctttggagcctcct
cttctctttctgctggaggaatacaaaaattacctagatgctgcaaacatgtccatgagg
gtccggcgccactctgaccctgcccgccgaggggagctgagcgtgtgtgacagtattagc
gagtgggtaacggcggcggacaaaaagactgcagtggacatgtcgggcgggacggtcaca
gtccttgaaaaggtccctgtatcaaaaggccaactgaagcaatacttctacgagaccaag
tgcaatcccatgggttacacaaaagaaggctgcaggggcatagacaaaaggcattggaac
tcccagtgccgaactacccagtcgtacgtgcgggcccttaccatggatagcaaaaagaga
attggctggcgattcataaggatagacacttcttgtgtatgtacattgaccattaaaagg
ggaagatag

DBGET integrated database retrieval system