KEGG   Pan paniscus (bonobo): 100983902
Entry
100983902         CDS       T02283                                 

Gene name
LAT
Definition
(RefSeq) linker for activation of T-cells
  KO
K07362  linker for activation of T cells
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04014  Ras signaling pathway
pps04015  Rap1 signaling pathway
pps04064  NF-kappa B signaling pathway
pps04650  Natural killer cell mediated cytotoxicity
pps04658  Th1 and Th2 cell differentiation
pps04659  Th17 cell differentiation
pps04660  T cell receptor signaling pathway
pps04664  Fc epsilon RI signaling pathway
pps04666  Fc gamma R-mediated phagocytosis
pps05135  Yersinia infection
pps05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100983902 (LAT)
   04015 Rap1 signaling pathway
    100983902 (LAT)
   04064 NF-kappa B signaling pathway
    100983902 (LAT)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100983902 (LAT)
   04660 T cell receptor signaling pathway
    100983902 (LAT)
   04658 Th1 and Th2 cell differentiation
    100983902 (LAT)
   04659 Th17 cell differentiation
    100983902 (LAT)
   04664 Fc epsilon RI signaling pathway
    100983902 (LAT)
   04666 Fc gamma R-mediated phagocytosis
    100983902 (LAT)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100983902 (LAT)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100983902 (LAT)
SSDB
Motif
Pfam: LAT
Other DBs
NCBI-GeneID: 100983902
NCBI-ProteinID: XP_008959895
UniProt: A0A2R9BKZ7
Position
Un
AA seq 262 aa
MEEAILVPCMLGLLLLPILAMLMALCVHCHRLPGSYDSTSSDSLYPRGIQFKRPHTVAPW
PPAYPPVTSYPPLSQPDLLPIPRSPQPLGGSHRTPSSRQDSDGANSVASYENEGASGIRG
AQAGWGVWGPSWTRLTPVSLPPEPACEDADEDEDDYHNPGYLVVLPDSTPATSTAAPSAP
ALSTPGIRDSAFSTESIDDYVNVPESGESAEASLDGSREYVNVSQELHPGAAKTEPAALS
SQEAEEVEEEGAPDYENLQELN
NT seq 789 nt   +upstreamnt  +downstreamnt
atggaggaggccatcctggtcccctgcatgctggggctcctgctgctgcccatcctggcc
atgttgatggcactgtgtgtgcactgccacagactgccaggctcctacgacagcacatcc
tcagatagtttgtatccaaggggcatccagttcaaacggcctcacacggttgccccctgg
ccacctgcctacccgcctgtcacctcctacccacccctgagccagccagacctgctcccc
atcccaagatccccgcagccccttgggggctcccaccggacgccatcttcccggcaggat
tctgatggtgccaacagtgtggcgagctacgagaacgagggtgcgtctgggatccgaggt
gcccaggctgggtggggagtctggggtccgtcctggactaggctgacccctgtgtcgtta
cccccagaaccagcctgtgaggatgcggatgaggatgaggacgactatcacaacccgggc
tacctggtggtgcttcctgacagcaccccggccactagcactgctgccccatcagctcct
gcactcagcacccctggcatccgagacagtgccttctccacggagtccattgatgattac
gtgaacgttccggagagcggggagagcgcagaagcgtctctggatggcagccgggagtat
gtgaatgtgtcccaggaactgcatcctggagcggctaagactgagcctgccgccctgagt
tcccaggaggcagaggaagtggaggaagagggggctccagattacgagaatctgcaggag
ctgaactga

DBGET integrated database retrieval system