KEGG   Pan paniscus (bonobo): 100984436
Entry
100984436         CDS       T02283                                 

Gene name
IL21
Definition
(RefSeq) interleukin 21
  KO
K05434  interleukin 21
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04060  Cytokine-cytokine receptor interaction
pps04630  JAK-STAT signaling pathway
pps04659  Th17 cell differentiation
pps05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100984436 (IL21)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100984436 (IL21)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    100984436 (IL21)
 09160 Human Diseases
  09163 Immune disease
   05321 Inflammatory bowel disease
    100984436 (IL21)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pps04052]
    100984436 (IL21)
Cytokines and growth factors [BR:pps04052]
 Cytokines
  Interleukins
   100984436 (IL21)
SSDB
Motif
Pfam: IL15
Other DBs
NCBI-GeneID: 100984436
NCBI-ProteinID: XP_003816452
UniProt: A0A2R9BR35
Position
4
AA seq 162 aa
MRSSPGNMERIVICLMVIFLGTLVHKSSSQGQDRHMIRMRQLIDIVDQLKNYVNDLVPEF
LPAPEDVETNCEWSAFSCFQKAQLKSANTGNNERIINVSIKKLKRKPPSTNAGRRQKHRL
TCPSCDSYEKKPPKEFLERFKSLLQKMIHQHLSSRTHGSEDS
NT seq 489 nt   +upstreamnt  +downstreamnt
atgagatccagtcctggcaacatggagaggattgtcatctgtctgatggtcatcttcttg
gggacactggtccacaaatcaagctctcaaggtcaagatcgccacatgattagaatgcgt
caacttatagatattgttgatcagctgaaaaattatgtgaatgacttggtccctgaattt
ctgccagctccagaagatgtagagacaaactgtgagtggtcagctttttcctgttttcag
aaggcccaactaaagtcagcaaatacaggaaacaatgaaaggataatcaatgtatcaatt
aaaaagctgaagaggaaaccaccttccacaaatgcagggagaagacagaaacacagacta
acatgcccttcatgtgattcttatgagaaaaaaccacccaaagaattcctagaaagattc
aaatcacttctccaaaagatgattcatcagcatctgtcctctagaacacacggaagtgaa
gattcctga

DBGET integrated database retrieval system