KEGG   Pan paniscus (bonobo): 100984583
Entry
100984583         CDS       T02283                                 

Gene name
PDGFB
Definition
(RefSeq) platelet derived growth factor subunit B
  KO
K17386  platelet-derived growth factor subunit B
Organism
pps  Pan paniscus (bonobo)
Pathway
pps01521  EGFR tyrosine kinase inhibitor resistance
pps04010  MAPK signaling pathway
pps04014  Ras signaling pathway
pps04015  Rap1 signaling pathway
pps04020  Calcium signaling pathway
pps04072  Phospholipase D signaling pathway
pps04151  PI3K-Akt signaling pathway
pps04510  Focal adhesion
pps04540  Gap junction
pps04630  JAK-STAT signaling pathway
pps04810  Regulation of actin cytoskeleton
pps05167  Kaposi sarcoma-associated herpesvirus infection
pps05200  Pathways in cancer
pps05206  MicroRNAs in cancer
pps05211  Renal cell carcinoma
pps05214  Glioma
pps05215  Prostate cancer
pps05218  Melanoma
pps05231  Choline metabolism in cancer
pps05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100984583 (PDGFB)
   04014 Ras signaling pathway
    100984583 (PDGFB)
   04015 Rap1 signaling pathway
    100984583 (PDGFB)
   04630 JAK-STAT signaling pathway
    100984583 (PDGFB)
   04020 Calcium signaling pathway
    100984583 (PDGFB)
   04072 Phospholipase D signaling pathway
    100984583 (PDGFB)
   04151 PI3K-Akt signaling pathway
    100984583 (PDGFB)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100984583 (PDGFB)
   04540 Gap junction
    100984583 (PDGFB)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100984583 (PDGFB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100984583 (PDGFB)
   05206 MicroRNAs in cancer
    100984583 (PDGFB)
   05231 Choline metabolism in cancer
    100984583 (PDGFB)
  09162 Cancer: specific types
   05214 Glioma
    100984583 (PDGFB)
   05218 Melanoma
    100984583 (PDGFB)
   05211 Renal cell carcinoma
    100984583 (PDGFB)
   05215 Prostate cancer
    100984583 (PDGFB)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100984583 (PDGFB)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    100984583 (PDGFB)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100984583 (PDGFB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pps04052]
    100984583 (PDGFB)
   00536 Glycosaminoglycan binding proteins [BR:pps00536]
    100984583 (PDGFB)
Cytokines and growth factors [BR:pps04052]
 Growth factors
  Growth factors (RTK binding)
   100984583 (PDGFB)
Glycosaminoglycan binding proteins [BR:pps00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   100984583 (PDGFB)
SSDB
Motif
Pfam: PDGF PDGF_N
Other DBs
NCBI-GeneID: 100984583
NCBI-ProteinID: XP_003821658
UniProt: A0A2R9ACQ2
Position
22
AA seq 241 aa
MNRCWALFLSLCCYLRLVSAEGDPIPEELYEMLSDHSIRSFDDLQRLLHGDPGEEDGAEL
DLNMTRSHSGGELESLARGRRSLGSLTVAEPAMIAECKTRTEVFEISRRLIDRTNANFLV
WPPCVEVQRCSGCCNNRNVQCRPTQVQLRPVQVRKIEIVRKKPIFKKATVTLEDHLACKC
ETVAAARPVTRSPGGSQEQRAKTPQTRVTIRTVRVRRPPKGKHRKFKHTHDKTALKETLG
A
NT seq 726 nt   +upstreamnt  +downstreamnt
atgaatcgctgctgggcgctcttcctgtctctctgctgctacctgcgtctggtcagcgcc
gagggggaccccattcccgaggagctttatgagatgctgagtgaccactcgatccgctcc
tttgatgatctccaacgcctgctgcacggagaccccggagaggaagatggggccgagttg
gacctgaacatgacccgctcccactctggaggcgagctggagagcttggctcgtggaaga
aggagcctgggttccctgaccgttgctgagccggccatgatcgccgagtgcaagacgcgc
accgaggtgttcgagatctcccggcgcctcatagaccgcaccaacgccaacttcctggtg
tggccgccctgcgtggaggtgcagcgctgctccggctgctgcaacaaccgcaacgtgcag
tgccgccccacccaggtgcagctgcgacctgtccaggtgagaaagatcgagattgtgcgg
aagaagccaatctttaagaaggccacggtgacgctggaagaccacctggcatgcaagtgt
gagacagtggcagctgcacggcctgtgacccgaagcccggggggttcccaggagcagcga
gccaaaacgccccaaactcgggtgaccattcggacggtgcgagtccgccggccccccaag
ggcaagcaccggaaattcaagcacacgcatgacaagacggcactgaaggagaccctcgga
gcctag

DBGET integrated database retrieval system