KEGG   Pan paniscus (bonobo): 100984656Help
Entry
100984656         CDS       T02283                                 

Gene name
KAT2A
Definition
(RefSeq) lysine acetyltransferase 2A
  KO
K06062  histone acetyltransferase [EC:2.3.1.48]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04330  Notch signaling pathway
pps04919  Thyroid hormone signaling pathway
pps05166  Human T-cell leukemia virus 1 infection
pps05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    100984656 (KAT2A)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    100984656 (KAT2A)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100984656 (KAT2A)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100984656 (KAT2A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:pps03021]
    100984656 (KAT2A)
   03036 Chromosome and associated proteins [BR:pps03036]
    100984656 (KAT2A)
Enzymes [BR:pps01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100984656 (KAT2A)
Transcription machinery [BR:pps03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     100984656 (KAT2A)
Chromosome and associated proteins [BR:pps03036]
 Eukaryotic type
  Histone modification proteins
   HATs (histone acetyltransferases)
    100984656 (KAT2A)
   HAT complexes
    PCAF complex
     100984656 (KAT2A)
    STAGA complex
     100984656 (KAT2A)
    TFTC complex
     100984656 (KAT2A)
    SAGA complex
     100984656 (KAT2A)
    SLIK complex
     100984656 (KAT2A)
    ADA-HAT complex
     100984656 (KAT2A)
    HAT-A2 complex
     100984656 (KAT2A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PCAF_N Bromodomain Acetyltransf_1 Acetyltransf_10 Acetyltransf_7 T2SSM
Motif
Other DBs
NCBI-GeneID: 100984656
NCBI-ProteinID: XP_003813914
UniProt: A0A2R9C6Z6
Position
17
AA seq 837 aa AA seqDB search
MAEPSQAPTPAPAAQPRPLQSPAPAPTPTPAPSPASAPIPTPTPAPAPAPAAAPASSTGT
GGPGVGSGGAGSGGDPARPGLSQQQRASQRKAQVRGLPRAKKLEKLGVFSACKANETCKC
NGWKNPKPPTAPRMDLQQPAANLSELCRSCEHPLADHVSHLENVSEDEINRLLGMVVDVE
NLFMSVHKEEDTDTKQVYFYLFKLLRKCILQMTRPVVEGSLGSPPFEKPNIEQGVLNFVQ
YKFSHLAPRERQTMFELSKMFLLCLNYWKLETPAQFRQRSQAEDVATYKVNYTRWLCYCH
VPQSCDSLPRYETTHVFGRSLLRSIFTVTRRQLLEKFRVEKDKLVPEKRTLILTHFPKFL
SMLEEEIYGANSPIWESGFTMPPSEGTQLVPRPASVSAAVVPSTPIFSPSMGGGSNSSLS
LDSAGAEPMPGEKRTLPENLTLEDAKRLRVMGDIPMELVNEVMLTITDPAAMLGPETSLL
SANAARDETARLEERRGIIEFHVIGNSLTPKANRRVLLWLVGLQNVFSHQLPRMPKEYIA
RLVFDPKHKTLALIKDGRVIGGICFRMFPTQGFTEIVFCAVTSNEQVKGYGTHLMNHLKE
YHIKHNILYFLTYADEYAIGYFKKQGFSKDIKVPKSRYLGYIKDYEGATLMECELNPRIP
YTELSHIIKKQKEIIKKLIERKQAQIRKVYPGLSCFKEGVRQIPVESVPGIRETGWKPLG
KEKGKELKDPDQLYTTLKNLLAQIKSHPSAWPFMEPVKKSEAPDYYEVIRFPIDLKTMTE
RLRSRYYVTRKLFVADLQRVIANCREYNPPDSEYCRCASALEKFFYFKLKEGGLIDK
NT seq 2514 nt NT seq  +upstreamnt  +downstreamnt
atggcggaaccttcccaggccccgaccccggccccggctgcgcagccccggccccttcag
tccccagcccctgccccaactccgactcctgcacccagcccggcttcagccccgattccg
actcccaccccggcaccagcccctgccccagctgcagccccagccagcagcacagggact
ggggggcccggggtaggaagtgggggggccgggagcgggggggatccggctcgacctggc
ctgagccagcagcagcgcgccagtcagaggaaggcgcaagtccgggggctgccgcgcgcc
aagaagcttgagaagctaggggtcttctcggcttgcaaggccaatgaaacctgtaagtgt
aatggctggaaaaaccccaagccccccactgcaccccgcatggatctgcagcagccagct
gccaacctgagtgagctgtgccgcagttgtgagcaccccttggctgaccacgtatcccac
ttggagaatgtgtcagaggatgagataaaccgactgctggggatggtggtggatgtggag
aatctcttcatgtctgttcacaaggaagaggacacagacaccaagcaggtctatttctac
ctcttcaagctactgcggaaatgcatcctgcagatgacccggcccgtggtggaggggtcc
ctgggcagccctccatttgagaaacctaatattgagcagggtgtgctgaactttgtgcag
tacaagtttagtcacctggctccccgggagcggcagacgatgttcgagctctcaaagatg
ttcttgctctgccttaactactggaagcttgagacacctgcccagtttcggcagaggtct
caggctgaggacgtggctacctacaaggtcaattacaccagatggctctgttactgccac
gtgccccagagctgtgatagcctcccccgctacgaaaccactcatgtctttgggcgaagc
cttctccggtccattttcaccgttacccgccggcagctgctggaaaagttccgagtggag
aaggacaaattggtgcccgagaagaggaccctcatcctcactcacttccccaaattcctg
tccatgctggaggaggagatctatggggcaaactctccaatctgggagtcaggcttcacc
atgccaccctcagaggggacacagctggttccccggccagcttcagtcagtgcagcggtt
gttcccagcacccccatcttcagccccagcatgggtgggggcagcaacagctccctgagt
ctggattctgcaggggccgagcctatgccaggcgagaagaggacgctcccagagaacctg
accctggaggatgccaagcggctccgtgtgatgggtgacatccccatggagctggtcaat
gaggtcatgctgaccatcactgaccctgctgccatgctggggcctgagacaagcctgctt
tcggccaatgcggcccgggatgagacagcccgcctggaggagcgccgcggcatcatcgag
ttccatgtcatcggcaactcgctgacgcccaaggccaaccggcgggtgttgctgtggctc
gtggggctgcagaatgtcttttcccaccagctgccgcgcatgcctaaggagtatatcgcc
cgcctcgtctttgacccgaagcacaagactctggccttgatcaaggacgggcgggtcatc
ggtggcatctgcttccgcatgtttcccacccagggcttcacggagattgtcttctgtgct
gtcacctcgaatgagcaggtcaagggttatgggacccacttgatgaaccacctgaaggag
tatcacatcaagcacaacattctctacttcctcacctacgccgacgagtacgccatcggc
tacttcaaaaagcagggtttctccaaggacatcaaggtgcccaagagccgctacctgggc
tacatcaaggactacgagggagcgacgctgatggagtgtgagctgaatccccgcatcccc
tacacggagctgtcccacatcatcaagaagcagaaagagatcatcaagaagctgattgag
cgcaaacaggcccagatccgcaaggtctacccggggctcagctgcttcaaggagggcgtg
aggcagatccctgtggagagcgttcctggcattcgagagacgggctggaagccattgggg
aaggagaaggggaaggagctgaaggaccccgaccagctctacacaaccctcaaaaacctg
ctggcccaaatcaagtctcaccccagtgcctggcccttcatggagcctgtgaagaagtcg
gaggcccctgactactacgaggtcatccgcttccccattgacctgaagaccatgactgag
cggctgcgaagccgctactacgtgacccggaagctctttgtggccgacctgcagcgggtc
atcgccaactgtcgcgagtacaaccccccggacagcgagtactgccgctgtgccagcgcc
ctggagaagttcttctacttcaagctcaaggagggagggctcattgacaagtag

DBGET integrated database retrieval system