KEGG   Pan paniscus (bonobo): 100984661
Entry
100984661         CDS       T02283                                 

Gene name
AMHR2
Definition
(RefSeq) anti-Mullerian hormone receptor type 2
  KO
K04672  anti-mullerian hormone receptor type-2 [EC:2.7.11.30]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04060  Cytokine-cytokine receptor interaction
pps04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    100984661 (AMHR2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100984661 (AMHR2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pps01001]
    100984661 (AMHR2)
Enzymes [BR:pps01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     100984661 (AMHR2)
Protein kinases [BR:pps01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR2 family [OT]
   100984661 (AMHR2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Activin_recp Sensor Pkinase_fungal APH RELT
Other DBs
NCBI-GeneID: 100984661
NCBI-ProteinID: XP_003831060
UniProt: A0A2R8ZS13
Position
12
AA seq 573 aa
MLGSLGLWALLPTAVEAPPNRRTCVFFEAPGVRGSTKTLGELLDTGTELPRAIRCLYSRC
CFGIWNLTQDRAQVEMQGCRDSDEPGCESLHCDPSPRAHPSPGSTLFTCSCGTDFCNANY
SHLPPPGSPGTPGSQGPQAAPGESIWMALVLLGLFLLLLLLLGSIILALLQRKNYRVRGE
PVPEPRPDSGRDWSVELQELPELCFSQVIREGGHAVVWAGQLQGKLVAIKAFPPRSVAQF
QAERALYEIPGLQHDHIVRFITASRGGPGHLLSGPLLVLELHPKGSLCHYLTQYTSDWGS
SLRMALSLAQGLAFLHEERWQNGQYKPGIAHRDLSSQNVLIREDGSCAIGDLGLALVLPG
LTQPPAWTPTQPQGPAAIMEAGTQRYMAPELLDKTLDLQDWGMALRRADIYSLALLLWEI
LSRCPDLRPDSSPPPFQLAYEAELGNTPTSDELWALAVQERRRPYIPSTWRCFATDPDGL
RELLEDCWDADPEARLTAECVQQRLAALAHPQESHPFPESCPRGCPPLCPEDCTSIPAPT
ILPCRPQRSACHFSVQQGPCSRNPQPACTLSSV
NT seq 1722 nt   +upstreamnt  +downstreamnt
atgctagggtctttggggctttgggcattacttcccacagctgtggaagcacccccaaac
aggcgaacctgtgtgttctttgaggcccctggagtgcggggaagcacaaagacactggga
gagctgctagatacaggcacagagctccccagagctatccgctgcctctacagccgctgc
tgctttgggatctggaacctgacccaagaccgggcacaggtggaaatgcaaggatgccga
gacagtgatgagccaggctgtgagtccctccactgtgacccaagtccccgagcccacccc
agccctggctccactctcttcacctgctcctgtggcactgacttctgcaatgccaattac
agccatctgcctcctccagggagccctgggactcctggctcccagggtccccaggctgcc
ccaggtgagtccatctggatggcactggtgctgctggggctgttcctcctcctcctgctg
ctgctgggcagcatcatcttggccctgctacagcgaaagaactacagagtgcgaggtgag
ccagtgccagagccaaggccagactcaggcagggactggagtgtggagctgcaggagctg
cctgagctgtgtttctcccaggtaatccgggaaggaggtcatgcagtggtttgggccggg
cagctgcaaggaaaactggttgccatcaaggccttcccaccgaggtctgtggctcagttc
caagctgagagagcattgtacgaaattccaggcctacagcacgaccacattgtccgattt
atcactgccagccgggggggccctggccacctgctctctgggcccctgctggtactagaa
ctgcatcccaagggctccctgtgccactacttgacccagtataccagtgactggggaagt
tccctgcggatggcactgtccctggcccagggcctggcatttctccatgaggagcgctgg
cagaatggccaatataaaccaggtattgcccaccgagatctgagcagccagaatgtgctc
attcgggaagatggatcgtgtgccattggagacctgggccttgccttggtgctccctggc
ctcactcagccccctgcctggacccctactcaaccacaaggcccagctgccatcatggaa
gctggcacccagaggtacatggcaccagagctcttggacaagactctggacctacaggat
tggggcatggccctccgacgagctgatatttactctttggctctgctcctgtgggagata
ctgagtcgctgcccagatttgaggcctgacagcagtccaccacccttccaactggcctat
gaggcagaactgggcaatacccctacctctgatgagctatgggccttggcagtgcaggag
aggaggcgtccctacatcccatccacctggcgctgctttgccacagaccctgatgggctg
agggagctcctagaagactgttgggatgcagacccagaagcacggctgacagctgagtgt
gtacagcagcgcctggctgccttggcccatcctcaagagagccacccctttccagagagc
tgtccacgtggctgcccacctctctgcccagaagactgtacttcaattcctgcccctacc
atcctcccctgtaggcctcagcggagtgcctgccacttcagcgttcagcaaggcccttgt
tccaggaatcctcagcctgcctgtaccctttcttctgtgtaa

DBGET integrated database retrieval system