KEGG   Pan paniscus (bonobo): 100984704Help
Entry
100984704         CDS       T02283                                 

Gene name
GUCY1B3
Definition
(RefSeq) guanylate cyclase 1 soluble subunit beta
  KO
K12319  guanylate cyclase soluble subunit beta [EC:4.6.1.2]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps00230  Purine metabolism
pps01100  Metabolic pathways
pps04022  cGMP-PKG signaling pathway
pps04270  Vascular smooth muscle contraction
pps04540  Gap junction
pps04611  Platelet activation
pps04713  Circadian entrainment
pps04730  Long-term depression
pps04921  Oxytocin signaling pathway
pps04924  Renin secretion
pps04970  Salivary secretion
Brite
KEGG Orthology (KO) [BR:pps00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100984704 (GUCY1B3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04022 cGMP-PKG signaling pathway
    100984704 (GUCY1B3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100984704 (GUCY1B3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100984704 (GUCY1B3)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    100984704 (GUCY1B3)
   04924 Renin secretion
    100984704 (GUCY1B3)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100984704 (GUCY1B3)
  09154 Digestive system
   04970 Salivary secretion
    100984704 (GUCY1B3)
  09156 Nervous system
   04730 Long-term depression
    100984704 (GUCY1B3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100984704 (GUCY1B3)
Enzymes [BR:pps01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     100984704 (GUCY1B3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc HNOBA HNOB 4_1_CTD
Motif
Other DBs
NCBI-GeneID: 100984704
NCBI-ProteinID: XP_003822610
UniProt: A0A2R8ZGT7
Position
4
AA seq 619 aa AA seqDB search
MYGFVNHALELLVIRNYGPEVWEDIKKEAQLDEEGQFLVRIIYDDSKTYDLVAAASKVLN
LNAGEILQMFGKMFFVFCQESGYDTILRVLGSNVREFLQNLDALHDHLATIYPGMRAPSF
RCTDAEKGKGLILHYYSEREGLQDIVIGIIKTVAQQIHGTEIDMKVIQQRNEECDHTQFL
IEEKESKEEDFYEDLDRFEENGTQESRISPYTFCKAFPFHIIFDRDLVVTQCGNAIYRVL
PQLQPGNCSLLSVFSLVRPHIDISFHGILSHINTVFVLRSKEGLLDVEKLECEDELTGTE
ISCLRLKGQMIYLPEADSILFLCSPSVMNLDDLTRRGLYLSDIPLHDATRDLVLLGEQFR
EEYKLTQELEILTDRLQLTLRALEDEKKKTDTLLYSVLPPSVANELRHKRPVPAKRYDNV
TILFSGIVGFNAFCSKHASGEGAMKIVNLLNDLYTRFDTLTDSRKNPFVYKVETVGDKYM
TVSGLPEPCIHHARSICHLALDMMEIAGQVQVDGESVQITIGIHTGEVVTGVIGQRMPRY
CLFGNTVNLTSRTETTGEKGKINVSEYTYRCLMSPENSDPQFHLEHRGPVSMKGKKEPMQ
VWFLSRKNTGTEETKQDDD
NT seq 1860 nt NT seq  +upstreamnt  +downstreamnt
atgtacggatttgtgaatcacgccctggagctgctggtgatccgcaattacggccccgag
gtgtgggaagacatcaaaaaagaggcacagttagatgaagaaggacagtttcttgtcaga
ataatatatgatgactccaaaacttatgatttggttgctgctgcaagcaaagtcctcaat
ctcaatgctggagaaatcctccaaatgtttgggaagatgtttttcgtcttttgccaagaa
tctggttatgatacaatcttgcgtgtcctgggctctaatgtcagagaatttctacagaac
cttgatgctctgcacgaccaccttgctaccatctacccaggaatgcgtgcaccttccttt
aggtgcactgatgcagaaaagggcaaaggactcattttgcactactactcagagagagaa
ggacttcaggatattgtcattggaatcatcaaaacagtggcgcaacaaatccatggcact
gaaatagacatgaaggttattcagcaaagaaatgaagaatgtgatcatactcaattttta
attgaagaaaaagagtcaaaagaagaggatttttatgaagatcttgacagatttgaagaa
aatggtacccaggaatcacgcatcagcccatatacattctgcaaagcttttccttttcat
ataatatttgaccgggacctagtggtcactcagtgtggcaatgctatatacagagttctc
ccccagctccagcctgggaattgcagccttctgtctgtcttctcgctggttcgtcctcat
attgatattagtttccatgggatcctttctcacatcaatactgtttttgtattgagaagc
aaggaaggattgttggatgtggagaaattagaatgtgaggatgaactgactgggactgag
atcagctgcttacgtctcaagggtcaaatgatctacttacctgaagcagatagcatactt
tttctatgttcaccaagtgtcatgaacctggacgatttgacaaggagagggctgtatcta
agtgacatccctctgcatgatgccacgcgcgatctcgttcttttgggagaacaatttaga
gaggaatacaaactcacccaagaactggaaatcctcactgacaggctacagctcacgtta
agagccctggaagatgaaaagaaaaagacagacacattgctgtattctgtccttcctccg
tctgttgccaatgagctgcggcacaagcgtccagtgcctgccaaaagatatgacaatgtg
accatcctctttagtggcattgtgggcttcaatgctttctgtagcaagcatgcatctgga
gaaggagccatgaagatcgtcaacctcctcaacgacctctacaccagatttgacacactg
actgattcccggaaaaacccatttgtttataaggtggagactgttggtgacaagtatatg
acagtgagtggtttaccagagccatgcattcaccatgcacgatccatctgccacctggcc
ttggacatgatggaaattgctggccaggttcaagtagatggtgaatctgttcagataaca
atagggatacacactggagaggtagttacaggtgtcataggacagcggatgcctcgatac
tgtctttttgggaatactgtcaacctcacgagccgaacagaaaccacaggagaaaaggga
aaaataaatgtgtctgaatatacatacagatgtcttatgtctccagaaaattcagatcca
caattccacttggagcacagaggcccagtgtccatgaagggcaaaaaagaaccaatgcaa
gtttggtttctatccagaaaaaatacaggaacagaggaaacaaagcaggatgatgactga

DBGET integrated database retrieval system