KEGG   Pan paniscus (bonobo): 100984802Help
Entry
100984802         CDS       T02283                                 

Gene name
ZHX1
Definition
(RefSeq) zinc fingers and homeoboxes 1
Organism
pps  Pan paniscus (bonobo)
SSDB OrthologParalogGFIT
Motif
Pfam: Homeodomain zf_C2H2_ZHX Homez Homeobox_KN Cpn60_TCP1
Motif
Other DBs
NCBI-GeneID: 100984802
NCBI-ProteinID: XP_003820532
UniProt: A1YG99
Position
8
AA seq 873 aa AA seqDB search
MASRRKSTTPCMVLASEQDPDLELISDLDEGPPVLTPVENTRAESISSDEEVHESVDSDN
QQNKKVEGGYECKYCTFQTPDLNMFTFHVDSEHPNVVLNSSYVCVECNFLTKRYDALSEH
NLKYHPGEENFKLTMVKRNNQTIFEQTINDLTFDGSFIKEENAEQAESTEVSSSGISISK
TPIMKMMKNKVENKRIAVHHNSVEDVPEEKENEIKPDREEIVENPSSSASESNTSTSIVN
RIHPSTASTVVTPAAVLPGLAQVITAVSAQQNSNLIPKVLIPVNSIPTYNAALDNNPLLL
NTYNKFPYPTMSEITVLSAQAKYTEEQIKIWFSAQRLKHGVSWTPEEVEEARRKQFNGTV
HTVPQTITVIPTHISTGSNGLPSILQTCQIVGQPGLVLTQVAGTNTLPVTAPIALTVAGV
PSQNNIQKSQVPAAQPTAETKPATAAVPTSQSVKHETALVNPDSFGIRAKKTKEQLAELK
VSYLKNQFPHDSEIIRLMKITGLTKGEIKKWFSDTRYNQRNSKSNQCLHLNNDSSTTIII
DSSDETTESPTVGTAQPKQSWNPFPDFTPQKFKEKTAEQLRVLQASFLNSSVLTDEELNR
LRAQTKLTRREIDAWFTEKKKSKALKEEKMEIDESNAGSSKEEAGETSPGDESGAPKSGS
TGKICKKTPEQLHMLKSAFVRTQWPSPEEYDKLAKESGLARTDIVSWFGDTRYAWKNGNL
KWYYYYQSANSSSMNGLSSLRKRGRGRPKGRGRGRPRGRPRGSKRINNWDRGPSLIKFKT
GTAILKDYYLKHKFLNEQDLDELVNKSHMGYEQVREWFAERQRRSELGIELFEENEEEDE
VIDDQEEDEEETDDSDTWEPPRHVKRKLSKSDD
NT seq 2622 nt NT seq  +upstreamnt  +downstreamnt
atggcaagcaggcgaaaatcaacaacaccttgcatggtccttgccagtgaacaagatcca
gaccttgagttgatatcagatttggatgaaggtcctcctgtgcttacacctgtagaaaac
accagagcagagagtatctcaagtgatgaagaggttcatgaatctgtggattcagacaat
cagcaaaataaaaaagttgaaggtggatatgaatgtaaatattgtacttttcaaactcca
gatctaaatatgtttacttttcatgtggattcggaacatcccaatgtagtgctaaattca
tcctatgtttgtgtcgaatgcaattttcttaccaaaaggtatgatgcactttctgagcat
aatctgaaatatcacccaggagaagagaattttaagttgactatggtgaaacgtaataac
cagacaatctttgaacaaacaataaatgatctgacttttgatggtagttttattaaagag
gagaatgcagagcaagcagaatctacagaagtttcttcttcgggaatatctatcagtaaa
actcctatcatgaaaatgatgaaaaataaagtggaaaataaacggattgcagttcatcat
aactcagttgaggacgttcctgaagagaaagagaatgaaatcaaaccagatcgtgaagaa
attgtagaaaatccaagttcttcagcttctgaatctaatacaagtacttccattgtaaac
agaatacatccaagtactgccagcacagtagtgacaccagcagcagttcttcctggattg
gcacaggtgataactgctgtatctgctcagcagaattctaatttgattcccaaagtctta
atccctgttaatagcattcccacctacaatgctgcattggataacaatccccttttactt
aacacctacaacaagttcccttacccaacaatgtcagaaattacagttctttctgctcaa
gcaaaatatacagaggaacagatcaagatatggttttcagcccaacgtttaaaacatggt
gttagttggactcccgaggaagtagaggaggcaagaaggaaacaattcaatggaacagtg
catactgtacctcagaccataactgttattcctacacacatttccacagggagtaatggt
ttaccatctattttacagacatgccaaatagttggtcagcctggtctggtccttactcaa
gtggctggaacaaacaccttgccagttacagcacctatagccttgacagtggcaggcgtt
ccaagtcaaaataatatacagaaaagtcaggtacctgctgctcagcctactgcagaaaca
aagccagcaacagcagcagttccaacttctcaaagtgtcaaacatgaaactgcattggta
aaccctgattcatttggcattcgggcaaaaaagacaaaagagcaactggcagaattaaaa
gttagctaccttaaaaatcagtttccccatgattcagaaattatcagacttatgaaaata
acaggcctgacgaaaggagagattaaaaaatggtttagtgacacaaggtacaaccagaga
aattcaaagagtaatcagtgcttacatctcaacaatgattcctctaccaccattattata
gactccagtgatgaaaccacggaatccccaactgttggtactgcacagcctaagcaatcc
tggaatccttttcctgactttactccccaaaagtttaaagagaaaactgcagagcagctt
cgtgtccttcaggcaagttttctcaacagctctgtacttacagatgaagaattaaatagg
ttaagggcacaaaccaaacttaccagaagagaaatcgatgcttggtttacagagaagaag
aaatcaaaagctttaaaggaagagaaaatggaaatagatgaaagtaatgcaggtagttcc
aaagaagaagctggagaaacttctcctggagatgaatctggtgcacctaagtcagggagt
acaggcaagatatgtaaaaaaacacctgagcagctgcacatgcttaagagtgcatttgtc
cggacacagtggccatcaccagaagagtatgacaagttggccaaagaaagtgggcttgct
agaacagacatagttagttggtttggggacacccgttatgcttggaagaatggaaacttg
aaatggtactactactatcagagcgccaattcaagtagtatgaatggtctgtcttccctt
aggaaaagagggagagggagacccaaaggacggggaagaggaagaccgcgtgggcggcct
agaggaagcaaaagaattaacaactgggacaggggaccatcactcataaaatttaaaact
ggaactgcaatacttaaggattattacctgaagcacaagtttcttaatgagcaagacctt
gatgaacttgttaacaaatcacatatgggctatgagcaggtcagagagtggtttgcagaa
agacagagaagatcagaattaggtatagaattatttgaggaaaatgaggaggaagatgaa
gttattgatgaccaggaagaggatgaagaagaaacagatgatagtgacacttgggaacct
ccacgacatgtgaaacggaagctgtctaaatcagatgactga

DBGET integrated database retrieval system