KEGG   Pan paniscus (bonobo): 100984892
Entry
100984892         CDS       T02283                                 

Gene name
PLD1
Definition
(RefSeq) phospholipase D1
  KO
K01115  phospholipase D1/2 [EC:3.1.4.4]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps00564  Glycerophospholipid metabolism
pps00565  Ether lipid metabolism
pps01100  Metabolic pathways
pps04014  Ras signaling pathway
pps04024  cAMP signaling pathway
pps04071  Sphingolipid signaling pathway
pps04072  Phospholipase D signaling pathway
pps04144  Endocytosis
pps04666  Fc gamma R-mediated phagocytosis
pps04724  Glutamatergic synapse
pps04912  GnRH signaling pathway
pps04928  Parathyroid hormone synthesis, secretion and action
pps05200  Pathways in cancer
pps05212  Pancreatic cancer
pps05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:pps00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    100984892 (PLD1)
   00565 Ether lipid metabolism
    100984892 (PLD1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100984892 (PLD1)
   04072 Phospholipase D signaling pathway
    100984892 (PLD1)
   04071 Sphingolipid signaling pathway
    100984892 (PLD1)
   04024 cAMP signaling pathway
    100984892 (PLD1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100984892 (PLD1)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    100984892 (PLD1)
  09152 Endocrine system
   04912 GnRH signaling pathway
    100984892 (PLD1)
   04928 Parathyroid hormone synthesis, secretion and action
    100984892 (PLD1)
  09156 Nervous system
   04724 Glutamatergic synapse
    100984892 (PLD1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100984892 (PLD1)
   05231 Choline metabolism in cancer
    100984892 (PLD1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    100984892 (PLD1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pps04131]
    100984892 (PLD1)
Enzymes [BR:pps01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.4  phospholipase D
     100984892 (PLD1)
Membrane trafficking [BR:pps04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    100984892 (PLD1)
 Endosome - Golgi transport
  Others
   Others
    100984892 (PLD1)
SSDB
Motif
Pfam: PLDc_2 PX PLDc PH DUF3785
Other DBs
NCBI-GeneID: 100984892
NCBI-ProteinID: XP_003831986
UniProt: A0A2R9AP38
Position
3
AA seq 1036 aa
MSLKNEPRVNTSALQKIAADMSNIIENLDTRELHFEGEEVDYDVSPSDPKIQEVYIPFSA
IYNTQGFKEPNIQTYLSGCPIKAQVLEVERFTSTTRVPSINLYTIELTHGEFKWQVKRKF
KHFQEFHRELLKYKAFIRIPIPTRRHTFRRQNVREEPREMPSLPRSSENMIREEQFLGRR
KQLEDYLTKILKMPMYRNYHATTEFLDISQLSFIHDLGPKGIEGMIMKRSGGHRIPGLNC
CGQGRACYRWSKRWLIVKDSFLLYMKPDSGAIAFVLLVDKEFKIKVGKKETETKYGIRID
NLSRTLILKCNSYRHARWWGGAIEEFIQKHGTNFLKDHRFGSYAAIQENALAKWYVNAKG
YFEDVANAMEEANEEIFITDWWLSPEIFLKRPVVEGNRWRLDCILKRKAQQGVRIFIMLY
KEVELALGINSEYTKRTLMRLHPNIKVMRHPDHVSSTVYLWAHHEKLVIIDQSVAFVGGI
DLAYGRWDDNEHRLTDVGSVKRVTSGPSLGSLPPAAMESMESLRLKDKNEPDQNLPIQKS
IDDVDSKLKGIGKPRKFSKFSLYKQLHRHHLHNADSISSIDSTSNTGSIRSLQTGVGELH
GETRFWHGKDYCNFVFKDWVQLDKPFADFIDRYSTPRMPWHDIASAVHGKAARDVARHFI
QRWNFTKIMKSKYRSLSYPFLLPKSQTTAHELRYQVPGSVHANVQLLRSAADWSAGIKYH
EESIHAAYVHVIENSRHYIYIENQFFISCADDKVVFNKIGDAIAQRILKAHRENQKYRVY
VVIPLLPGFEGDISTGGGNALQAIMHFNYRTMCRGENSILGQLKAELGNQWINYISFCGL
RTHAELEGNLVTELIYVHSKLLIADDNTVIIGSANINDRSMLGKRDSEMAVIVQDTETVP
SVMDGKEYQAGRFARGLRLQCFRVVLGYLDDPSEDIQDPVSDKFFKEVWVSTAARNATIY
DKVFRCLPNDEVHNLIQLRDFINKPVLAKEDPIRAEEELKKIRGFLVQFPFYFLSEESLL
PSVGTKEAIVPMEVWT
NT seq 3111 nt   +upstreamnt  +downstreamnt
atgtcactgaaaaacgagccacgggtaaatacctctgcactgcagaaaattgctgctgac
atgagtaatatcatagaaaatctggacacgcgggaactccactttgagggagaggaggta
gactacgacgtgtctcccagcgatcccaagatacaagaagtgtatatccctttctctgct
atttataacactcaaggatttaaggagcctaatatacagacgtatctctccggctgtcca
ataaaagcacaagttctggaagtggaacgcttcacatctacaacaagggtaccaagtatt
aatctttacactattgaattaacacatggggaatttaaatggcaagttaagaggaaattc
aagcattttcaagaatttcacagagagctgctcaagtacaaagcctttatccgaatcccc
attcccactagaagacacacgtttaggaggcaaaacgtcagagaggagcctcgagagatg
cccagtttgccccgttcatctgaaaacatgataagagaagaacaattccttggtagaaga
aaacaactggaagattacttgacaaagatactaaaaatgcccatgtatagaaactatcat
gccacaacagagtttcttgatataagccagctgtctttcatccatgatttgggaccaaag
ggcatagaaggtatgataatgaaaagatctggaggacacagaataccaggcttgaattgc
tgtggtcagggaagagcctgctacagatggtcaaaaagatggttaatagtgaaagattcc
tttttattgtatatgaaaccagacagcggtgccattgccttcgtcctgctggtagacaaa
gaattcaaaattaaggtggggaagaaggagacagaaacgaaatatggaatccgaattgat
aatctttcaaggacacttattttaaaatgcaacagctatagacatgctcggtggtgggga
ggggctatagaagaattcatccagaaacatggcaccaactttctcaaagatcatcgattt
gggtcatatgctgctatccaagagaatgctttagctaaatggtatgttaatgccaaagga
tattttgaagatgtggcaaatgcaatggaagaggcaaatgaagagatttttatcacagac
tggtggctgagtccagaaatcttcctgaaacgcccagtggttgagggaaatcgttggagg
ttggactgcattcttaaacgaaaagcacaacaaggagtgaggatcttcataatgctctac
aaagaggtggaactcgctcttggcatcaatagtgaatacaccaagaggactttgatgcgt
ctacatcccaacataaaggtgatgagacacccggatcatgtgtcatccaccgtctatttg
tgggctcaccatgagaagcttgtcatcattgaccaatcggtggcctttgtgggagggatt
gacctggcctatggaaggtgggacgacaatgagcacagactcacagacgtgggcagtgtg
aagcgggtcacttcaggaccatctctgggttccctcccacctgctgcaatggagtctatg
gaatccttaagactcaaagataaaaatgagcctgatcaaaacctacccatccagaagagt
attgatgatgtggattcaaaactgaaaggaataggaaagccaagaaagttctccaaattt
agtctctacaagcagctccacaggcaccacctgcacaacgcagatagcatcagcagcatt
gacagcacctccaataccgggtccatccgcagtttacagacaggtgtgggagagctgcat
ggggaaaccagattctggcatggaaaggactactgcaatttcgtcttcaaagactgggtt
caacttgataaaccttttgctgatttcattgacaggtactccacgccccggatgccctgg
catgacattgcctctgcagtccacgggaaggcggctcgtgatgtggcacgtcacttcatc
cagcgctggaacttcacgaaaattatgaaatcaaaatatcggtccctttcttatcctttt
ctgcttccaaagtctcaaacaacagcccatgagttgagatatcaagtgcctgggtctgtc
catgctaacgtacagttgctccgctctgctgctgattggtctgctggtataaagtaccat
gaagagtccatccacgccgcttatgtccatgtgatagagaacagcaggcactatatctat
atcgaaaaccagtttttcataagctgtgctgatgacaaagttgtgttcaacaagataggt
gatgccattgcccagaggatcctgaaagctcacagggaaaaccagaaataccgggtatat
gtcgtgataccacttctgccagggttcgaaggagacatttcaaccggtggaggaaatgct
ctacaggcaatcatgcacttcaactacagaaccatgtgcagaggagaaaattccatcctt
ggacagttaaaagcagagcttggtaatcagtggataaattacatatcattctgtggtctt
agaacacacgcagagctcgaaggaaacctagtcactgagcttatctatgtccacagcaag
ttgttaattgctgatgataacactgttattattggctctgccaacataaatgaccgcagc
atgctgggaaagcgtgacagtgaaatggctgtcattgtgcaagatacagagactgttcct
tcagtaatggatggaaaagagtaccaagctggccggtttgcccgaggacttcggctacag
tgctttagggttgtccttggctatcttgatgacccaagtgaggacattcaggatccagtg
agtgacaaattcttcaaggaggtgtgggtttcgacagcagctcgaaatgctacaatttat
gacaaggttttccggtgccttcccaatgatgaagtacacaatttaattcagctgagagac
tttataaacaagcccgtattagctaaggaagatcccattcgagctgaggaggaactgaag
aagatccgtggatttttggtgcaattccccttttatttcttgtctgaagaaagcctactg
ccttctgttggaaccaaagaggccatagtgcccatggaggtttggacttaa

DBGET integrated database retrieval system