KEGG   Pan paniscus (bonobo): 100984922Help
Entry
100984922         CDS       T02283                                 

Gene name
HTR3A
Definition
(RefSeq) 5-hydroxytryptamine receptor 3A
  KO
K04819  5-hydroxytryptamine receptor 3
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04726  Serotonergic synapse
pps04742  Taste transduction
Brite
KEGG Orthology (KO) [BR:pps00001]
 09150 Organismal Systems
  09156 Nervous system
   04726 Serotonergic synapse
    100984922 (HTR3A)
  09157 Sensory system
   04742 Taste transduction
    100984922 (HTR3A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:pps04040]
    100984922 (HTR3A)
Ion channels [BR:pps04040]
 Ligand-gated channels
  Serotonin (5-HT3)
   100984922 (HTR3A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Neur_chan_LBD Neur_chan_memb
Motif
Other DBs
NCBI-GeneID: 100984922
NCBI-ProteinID: XP_003805532
UniProt: A0A2R8ZM85
Position
11
AA seq 484 aa AA seqDB search
MRGKLAMLLWVQQALLALLLPTLLAQGEARRSRNTTRPALLRLSDYLLTNYRKGVRPVRD
WRKPTTVSIDVIVYAILNVDEKNQVLTTYIWYRQHWTDEFLQWNPEDFDNITKLSIPTDS
IWVPDILINEFVDVGKSPNIPYVYIRHQGEVQNYKPLQVVTACSLDIYNFPFDVQNCSLT
FTSWLHTIQDINISLWRLPEKVKSDRSVFMNQGEWELLGVLPYFREFSMESSNYYAEMKF
YVVIRRRPLFYVVSLLLPSIFLMVMDIVGFYLPPNSGERVSFKITLLLGYSVFLIIVSDT
LPATAIGTPLISVYFVVCMALLVISLAETIFIVRLVHKQDLQQPVPAWLRHLVLERIAWL
LCLREQSTSQRPPATSQATKTDDCSAMGNHCSHMGGPQDFEKSPRDRCSPPPPPREASLA
VCGLLQELSSIRQFLEKRDEIREVARDWLRVGSVLDKLLFHIYLLAVLAYSITLVILWSI
WQYA
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgcgtggaaagctcgctatgctgctgtgggtccagcaggcgctgctcgccttgctcctc
cccacactcctggcacagggagaagccaggaggagccgaaacaccaccaggcccgctctg
ctgaggctgtcggattaccttttgaccaactacaggaagggtgtgcgccccgtgagggac
tggaggaagccaaccaccgtatccattgacgtcattgtctatgccatcctcaacgtggat
gagaagaatcaggtgctgaccacctacatctggtaccggcagcactggactgatgagttt
ctccagtggaaccctgaggactttgacaacatcaccaagttgtccatccccacagacagc
atctgggtcccggacattctcatcaatgagttcgtggatgtggggaagtctccaaatatt
ccgtacgtgtatattcggcatcaaggcgaagttcagaactacaagccccttcaggtggtg
actgcctgtagcctcgacatctacaacttccccttcgatgtccagaactgctcgctgacc
ttcaccagttggctgcacaccatccaggacatcaacatctctttgtggcgcttgccagaa
aaggtgaaatccgacaggagtgtcttcatgaaccagggagagtgggagttgctgggggtg
ctgccctactttcgggagttcagcatggaaagcagtaactactatgcagaaatgaagttc
tatgtggtcatccgccggcggcccctcttctatgtggtcagcctgctgctgcccagcatc
ttcctcatggtcatggacatcgtgggcttctacctgccccctaacagtggcgagagggtc
tctttcaagatcacactcctcctgggctactcggtcttcctgatcatcgtttctgacacg
ctgccagccactgccatcggcactcctctcattagtgtctactttgtggtgtgcatggct
ctgctggtgataagtttggccgagaccatcttcattgtgcggctggtgcacaagcaagac
ctgcagcagcccgtgcctgcttggctgcgtcacctggttctggagagaatcgcctggcta
ctttgcctgagggagcagtcaacttcccagaggcccccagccacctcccaagccaccaag
actgatgactgctcagccatgggaaaccactgcagccacatgggaggaccccaggacttc
gagaagagcccgagggacagatgtagccctcccccaccacctcgggaggcctcactggcg
gtgtgtgggctgctgcaggagctgtcctccatccggcaattcctggaaaagcgggatgag
atccgagaggtggcccgagactggctgcgcgtgggctccgtgctggacaagctgctattc
cacatttacctgctggcggtgctggcctacagcatcaccctggttatcctctggtccatc
tggcagtacgcttaa

DBGET integrated database retrieval system